bismillahinbeatifullblueshade.jpg

''QALB AL-MU'MIN BAYT AR-RABB... The Heart of the Believer is the House of ALLAH.''

Unmarried Sufi Lovers are Welcome to Join my WhatsApp Group, Click for more details.

I began this site in the name of ALLAH Who hasn't taken unto Himself a wife or a son,& has NO partner in His sovereignty, nor has He any protecting friend through dependence.
For about one year I cut oranges, working at Orange Julius.
I've never tasted an Orange as Delicious as an Orange from al-Iskandaria, Misr. I think it's due to a Blessing from a Grave of Prophet of ALLAH. Although I like Oranges, the Orange Colored Chaunsa Mango from Pakistan is still my favourite fruit. Theenee (FIGS) waz (&) Zaytoon(OLIVES) are The Best Medicine in Fruits/& Vegtables.
"Reciting Surah Fatiha over Fresh THEENEE, before you eat them, shall bring us Barakah, in Sha Allah" Hadruth Ali KarmAllahu Wajhu, said If I were to write the vast meanings of Surah Al-Fathiha alone, I would need to load 70 camels with the commentary of Surah al-Fatiha (Meaning, in writing it's commentary, I would prepare so many papers that 70 camels would be needed to carry it.) Allahu Akbar! There is a Shia tradition from Imam al-Baqir Alay Salaam, that King Kabath decided to send his troops to destroy Jerusalem. The people gathered & went to a Prophet who had the Might of Allah, Hizqeel Alay Salaam. They requested him to relieve them from this trouble. He said, I will pray to Allah about it, at night. He prayed to Allah & Allah promised to save the people from the cruel king. Allah ordered the Angel of wind to take away the lives of King Kabath's troops & they all died. In the morning Hizqeel Alay Salaam informed his people that the troops are now, dead. The people of Palestine came out of their community dwellings & saw all of King Kabath's troops dead. After that Hizqeel Alay Salaam thought to himself that there is no difference between him & Sulayman Alay Salaam. He became depressed about the incident & became ill. Then he pleaded to Allahu-Shafee Kafee, to cure him from an unbearable disease. Allah ordered him to go near the THEENEE (FIG) tree & apply its juice on his chest. When he applied it, he Alay Salaam was cured. Hayat Al-Qulub Volume 1 By Muhammad Baqir Al-Majlisi
صلاة الكنز الأعظم والقطب المعظم للباز عبدالقادر الجيلاني قدس الله سره: بسم الله الرحمن الرحيم اللهم اجعل أفضل صلواتك أبدا وأنمى بركاتك سرمدا وأزكى تحياتك فضلا وعددا على أشرف الخلائق الإنسانية ومجمع الحقائق الإيمانية وطور التجليات الإحسانية ومهبط الأسرار الروحانية وعروس المملكة الربانية واسطة عقد النبيين ومقدم جيش المرسلين وقائد ركب الأنبياء المكرمين وأفضل الخلق أجمعين حامل لواء العز الأعلى ومالك أزمة المجد الأسنى شاهد أسرار الأزل ومشاهد أنوار السوابق الأول وترجمان لسان القدم ومنبع العلم والحلم والحكم ومظهر وجود الكلى والجزئى وإنسان عين الوجود العلوى والسفلى روح جسد الكونين وعين حياة الدارين المتحقق بأعلى رتب العبودية المتخلق بأخلاق المقامات الإصطفائية الخليل الأكرم والحبيب الأعظم سيدنا محمد بن عبدالله ابن عبدالمطلب خاتم النبيين وعلى آله وصحبه وسلم أجمعين عدد معلوماتك ومداد كلماتك كلما ذكرك الذاكرون وغفل عن ذكرك الغافلون وسلم كثيرا إلى يوم الدينوبداي يوم ميدين كما ينبغى لجلال وجهك وعظيم سلطانك . The Prayer of the Greatest Treasure & Pillar of Al-Baz Abdul Qadir Al-Jilani قداس الله سيرو In the name of Allah, The Most Beneficent & Merciful O Allah, send your Blessings-Best Ever & Increase your Blessings forever with Greetings in Abundance On the Most Honourable human being with the complex of religious facts, Evolution of acts of Kindness The Secret Keeper of Spiritual secrets & the BrideGroom of the Divine Kingdom Mediator of Prophets Contract & Provider of the Army of Messengers. The leader of the Noble Prophets & the Best in all creation The Bearer of the Supreme Glory & the Owner of the Banner of the Glory, with the secrets of isolation & the first lights of the previous ones, the translation of the tongue of existence, the source of knowledge, Dreams, Wisdom & the appearance of the presence of & partial The Eye of the upper & lower existence, the Soul of the Body of the Universe & the Eye of the life of the both worlds, who is fulfilled in the highest ranks of slavery The One who was created with the ethics of the religious positions. The Most Generous Human & the Greatest Beloved Our master Muhammad ﷺ bin Abdullah bin Abdul-Mutalib Jewel in the Rings of Prophets, his Family & companions, peace be upon them as well. Whenever you are remembered, & the ignorant forgets to remember You Blessings till the Day of Judgement, (& after that as Befits the Majesty of your face & the Greatness of your Authority.) My Lord رَبَّ الْعَالَمِيْن revealed the Qur’an in Layla-til Qadr, & مـحـمـد رسـول الله ﷺ carried the Qur’an when the Heavens & the الملائكة(Angels) couldn't. لَوْ أَنزَلْنَا هَذَا الْقُرْآنَ عَلَى جَبَلٍ لَّرَأَيْتَهُ خَاشِعًا مُّتَصَدِّعًا مِّنْ خَشْيَةِ اللَّهِ وَتِلْكَ الْأَمْثَالُ نَضْرِبُهَا لِلنَّاسِ لَعَلَّهُمْ يَتَفَكَّرُونَ Had We sent down this Quran on a mountain, verily you would have seen it humble itself & cleave asunder for fear of الله سبحانه وتعالى عز و جل رَبَّ الْعَالَمِيْن . Such are the similitudes that We propound to men that they may reflect. (Surat al-Hashr, 59:21) The Blessed Heart of مـحـمـد رسـول الله صلى الله عليه وسلم is always there & always strong:رسول الله صلى الله عليه وسلم is stronger than any mountain or universe, that's why الله سبحانه وتعالى عز و جل revealed to him the Mighty Qur’an. الله سبحانه وتعالى عز و جل said before, "If We sent the Qur’an on a mountain it would shatter," in another ayah we read الله سبحانه وتعالى عز و جل revealed it in the Night of Power." إِنَّا أَنزَلْنَاهُ فِي لَيْلَةِ الْقَدْرِوَمَا أَدْرَاكَ مَا لَيْلَةُ الْقَدْر We have sent down Holy Qur'an on the Night of Power. What do you know about the Night of Power? (Surat al-Qadr, 97:1-2) What is Layla-til Qadr? It's a hidden explanation الله سبحانه وتعالى عز و جل gave رسول الله ﷺ as a gift. If we recite Surah al-Qadr, الله قدوس repeated ‘Layla-til Qadr’ 3 times, & it is 9 letters: 3x9=27 letters, correct? ليلة القدير in hiya (in the last ayah), which is 2 more letters, so the Holy Qur’an was revealed on 29 letters, & every letter has its own secret. On the 1st night of Ramadan you have to know you entered the cave, & slowly the cave will open to you. فَفِرُّوا إِلَى اللَّهِ Run to الله سبحانه وتعالى (from all that is false & evil)! (Surat adh-Dhariyaat, 51:50) You begin your fast by stopping yourself from doing bad things & you implement that until the last 10 days; the 1'st 10 days is رحمة, the 2'nd 10 days is مغفرة, forgiveness, & the last 10 days is freedom from جهنم. In the last 10 days we observe ليلة القدير on any of the odd days & for anyone who observes it, that night when الله جل جلاله put the whole القرآن الكريم in to مـحـمـد رسـول الله ﷺ مبروك طاهر القلب, therefore its better than a (١٠٠٠)(alfa) ألف شهر of worship. بِسْمِ اللهِ الرَّحْمٰنِ الرَّحِيْمِ MORE AWLIYA-ALLAH SECRETS: ADVICE FOR SAFAR Everything has a door, & whoever recites Surat al-Ikhlas: قُلْ هُوَ ٱللَّهُ أَحَدٌ ١ ٱللَّهُ ٱلصَّمَدُ ٢ لَمْ يَلِدْ وَلَمْ يُولَدْ ٣ وَلَمْ يَكُن لَّهُۥ كُفُوًا أَحَدٌۢ ٤ will receive Divine Lights according to their intention from the Door of Ahadiyya (Oneness). Whenever it opens it never closes as Allah al-Samad الله الصم, Allah is Everlasting, Never Needing Anyone. شيخ محمد ناظم الحقاني النقشبندي: said try to recite Surat al-Ikhlas daily as many times as you can to remain safe in the month of Safar Al-Khayr & try to do as many good deeds as you can to remain in the safe protection of Awliya-Allah, in Sha allah الشيخ هشام قباني الشيخ محمد أبو الهدى اليعقوبي AlHasani's Mureed, شيك فيصل, hoped people would show up in the Masjid to pray: صلاة الخسوف‎ for Solar Eclipse, in which the مُؤَذِّن is supposed to say in Arabic: صلاة الجامعه ، صلاة الجامعه ، صلاة الخسوف يرحمكملله Congregation Prayer (2 times) "Lunar or Solar Eclipse Prayer" (A Solar Eclipse occurs when the Moon passes between Earth & the Sun, thereby obscuring the view of the Sun from a small part of the Earth) الله سبحانه وتعالى اللهم ارحمني يا ارحم الراحمين للَّهُمَّ إِنِّي أَعُوذُ بِكَ مِنَ الْبَرَصِ، وَالْجُنُونِ، وَالْجُذَامِ، وَمِنْ سَيِّئِ الأَسْقَامِ This is the Dua, I'd make before starting the Salaat: "Ya, Allah, I seek refuge in Thee from leprosy, madness, elephantiasis, & all nasty diseases." صلاة الخسوف‎, the Salaat consists of 2 Rakats. The difference between normal Salaat & the صلاة الخسوف‎ is that in each Rakaat the Imam reads the Quran twice , one normally after Surah Al Fatiha & one after Standing up from Ruku. The Imam then concludes the prayer normally. After the Salaat a Imam delivers a short sermon regarding the importance of صلاة الخسوف‎ & addresses the current situation of the Muslim Ummah, asking Forgiveness from الله سبحانه وتعالى. Great Dua Maghfirath in Sajood is:‏ "‏ اللَّهُمَّ اغْفِرْ لِي ذَنْبِي كُلَّهُ دِقَّهُ وَجِلَّهُ وَأَوَّلَهُ وَآخِرَهُ وَعَلاَنِيَتَهُ وَسِرَّهُ ‏"‏ اللهم ارحمني يا ارحم الراحمين If I were the Imam, I would recite in صلاة الخسوف‎ The قرآني Ayats from Surah 84, Al-Inshiqaq: فَلَآ أُقْسِمُ بِٱلشَّفَقِ ١٦ وَٱلَّيْلِ وَمَا وَسَقَ ١٧ وَٱلْقَمَرِ إِذَا ٱتَّسَقَ ١٨ لَتَرْكَبُنَّ طَبَقًا عَن طَبَقٍۢ ١٩ فَمَا لَهُمْ لَا يُؤْمِنُونَ ٢٠ وَإِذَا قُرِئَ عَلَيْهِمُ ٱلْقُرْءَانُ لَا يَسْجُدُونَ ۩ ٢١ The Guyanese Imam شيك فيصل requested me to place his link on my site, I suggested he translate Arab Hizbs(Prayers into English. below is his link: http://www.islamicforumonline.com/ Shaykh الحبيب عمر بن حفيظ used the أَبُو حَامِدٍ مُحَمَّدُ بْنُ مُحَمَّدٍ ٱلطُّوسِيُّ ٱلْغَزَالِيُّ رحمة الله عليه Imam الغزالى Keetab Sharh 'Aja'ib al-Qalb On The Elucidation of The Marvels of The Heart during his lessons. اللّهُمَّ صَلِّ عَلَى مَنْ رُوحُهُ مِحْرَابُ الأَرْوَاحِ وَالمَلَائِكَةِ وَالكَوْنِ، اللّهُمَّ صَلِّ عَلَى مَنْ هُوَ إِمَامُ الأَنْبِيَاءِ وَالمُرْسَلِينَ، اللّهُمَّ صَلِّ عَلَى مَنْ هُوَ إِمَامُ أَهْلِ الْجَنَّةِ عِبَادِ اللهِ الْمُؤْمِنِينَ. "Ya الله سبحانه وتعالى, shower Your blessings upon him whose spirit is the prayer-niche of all spirits, all angels, & all that exists! Ya الله سبحانه وتعالى, shower Your blessings upon him who is the Arch-leader of the divine Prophets & Messengers! Ya الله سبحانه وتعالى, shower Your blessings upon him, who is the Arch-leader of the people of the جنّات الفردوس, the servants of الله سبحانه وتعالى سُبْحَانَهُ وَتَعَالَىٰ عَمَّا يَقُولُونَ عُلُوًّا كَبِيرًا of the Believers!" Allāhumma ṣalli ʿalā man Rūḥuhu Miḥrābu-l-Arwāḥi wal-malāʾikati wal-Kawn. Allāhumma ṣalli ʿalā man huwa Imāmu-l-Anbiyāʾi wal-mursalīn. Allāhumma ṣalli ʿalā man huwa Imāmu ahli-l-Jannati ʿIbādi-l-Lāhi-l-Muʾminīn.أَعُوذُ بِاللَّهِ مِنَ الشَّيْطَانِ الرَّجِيمِ بِسْمِ ٱللَّٰهِ ٱلرَّحْمَٰنِ ٱلرَّحِيمِ Recite the Salawat of حَضْرَة Qutubul Haqeekee إِبْرَٰهِـۧم Dasookee قدس الله سره العزيز كرم الله وجهه Nafunالله سبحانه وتعالى Bee Wa BeBarkatihee fee Darayn بِسْمِ اللَّهِ الرَّحْمَنِ الرَّحِيم اَللَّهُمَّ صَلِّ عَلَى الذَّاتِ الْمُحَمَّدِيَّةِ، اَللَّطِيْفَةِ اْلاَحَدِيَّةِ، شَمْسِ سَمَاءِ اْلأَسْرَارِ، وَمَظْهَرِ اْلأَنْوَارِ، وَمَرْكَزِ مَدَارِ الْجَلاَلِ، وَقُطْبِ فَلَكِ الْجَمَالِ، اَللَّهُمَّ بِسِرِّهِ لَدَيْكَ، وَبِسَيْرِهِ اِلَيْكَ، آمِنْ خَوْفِيْ، وَأَقِلْ عَثْرَتِيْ، وَاَذْهِبْ حَزَنِيْ وَحِرْصِيْ، وَكُنْ لِيْ وَخُذْنِيْ اِلَيْكَ مِنِّيْ، وَارْزُقْنِيْ الْفَنَاءَ عَنِّيْ، وَلاَ تَجْعَلْنِيْ مَفْتُوْناً بِنَفْسِيْ مَحْجُوْباً بِحِسِّيْ وَاكْشِفْ لِيْ عَنْ كُلِّ سِرٍّ مَكْتُوْم ياَحَيُّ ياَقَيـُّوْمُ. بسم الله الرحمن الرحيم اللهم صل على سيدنا محمد الفاتح لما أغلق والخاتم لما سبق ناصر الحق بالحق والهادي إلى صراطك المستقيم وعلى آله حق قدره ومقداره العظيم اللَّهُمَّ إِنِّي أَسْأَلُكَ الْعَافِيَةَ فِي الدُّنْيَا وَالآخِرَةِ اللَّهُمَّ إِنِّي أَسْأَلُكَ الْعَفْوَ وَالْعَافِيَةَ فِي دِينِي وَدُنْيَاىَ وَأَهْلِي وَمَالِي اللَّهُمَّ اسْتُرْ عَوْرَتِي ‏وَآمِنْ رَوْعَاتِي اللَّهُمَّ احْفَظْنِي مِنْ بَيْنِ يَدَىَّ وَمِنْ خَلْفِي وَعَنْ يَمِينِي وَعَنْ شِمَالِي وَمِنْ فَوْقِي وَأَعُوذُ بِعَظَمَتِكَ أَنْ أُغْتَالَ مِنْ تَحْتِي﴾﷽﴿ اللَّهُمَّ صَلِّ عَلَىٰ سَيِّدِنَا مُحَمَّدٍ طِبِّ الْقُلُوبِ وَدَوَائِهَا ❁ وَعَافِيَةِ الْأَبدَانِ وَشِفَائِهَا ❁ وَقُوتِ الْأَرْوَاحِ وَغَذَائِهَا ❁ وَنُورِ الْأَبصَارِ وَضِيَائِهَا ❁ وَعَلَىٰ آلِهِ وَصَحْبِهِ وَسَلِّمْ بِسْمِ اللَّهِ الرَّحْمَنِ الرَّحِيم فَسُبْحَـٰنَ ٱللَّهِ حِينَ تُمْسُونَ وَحِينَ تُصْبِحُونَ ١٧ وَلَهُ ٱلْحَمْدُ فِى ٱلسَّمَـٰوَٰتِ وَٱلْأَرْضِ وَعَشِيًّۭا وَحِينَ تُظْهِرُونَ ١٨ يُخْرِجُ ٱلْحَىَّ مِنَ ٱلْمَيِّتِ وَيُخْرِجُ ٱلْمَيِّتَ مِنَ ٱلْحَىِّ وَيُحْىِ ٱلْأَرْضَ بَعْدَ مَوْتِهَا ۚ وَكَذَٰلِكَ تُخْرَجُونَ ١٩ وَمِنْ ءَايَـٰتِهِۦٓ أَنْ خَلَقَكُم مِّن تُرَابٍۢ ثُمَّ إِذَآ أَنتُم بَشَرٌۭ تَنتَشِرُونَ ٢٠ وَمِنْ ءَايَـٰتِهِۦٓ أَنْ خَلَقَ لَكُم مِّنْ أَنفُسِكُمْ أَزْوَٰجًۭا لِّتَسْكُنُوٓا۟ إِلَيْهَا وَجَعَلَ بَيْنَكُم مَّوَدَّةًۭ وَرَحْمَةً ۚ إِنَّ فِى ذَٰلِكَ لَـَٔايَـٰتٍۢ لِّقَوْمٍۢ يَتَفَكَّرُونَ ٢١ ما شاء الله تبارك الله يَا رَبِّ لَـكَ الْحَـمْـدُ كَـمَـا يَـنْـبَـغِـيْ لِـجَـلَالِ وَجْـهِـكَ وَعَـظِـيْـمِ سُــلْـطَـانِـكَ سُبْحَانَ الَّذِي سَخَّرَ لَنَا هَـٰذَا وَمَا كُنَّا لَهُ مُقْرِنِينَ وَإِنَّا إِلَىٰ رَبِّنَا لَمُنقَلِبُونَ سُبْحَانَ الَّذِي خَلَقَ الْأَزْوَاجَ كُلَّهَا مِمَّا تُنبِتُ الْأَرْضُ وَمِنْ أَنفُسِهِمْ وَمِمَّا لَا يَعْلَمُونَ الحمد لله وكفىٰ، والصلاة والسلام على إمام الأنبياء ول المرسلين رحمة للعالمين محمد مصطفى صلى الله عليه وآله وسلم The Salutation of Medicinal Virtue الصلوۃ والسلام علیک یا رسول اللہ وعلی آلک و اصحابک یا حبیب اللہ صلی اللہ علیہ وآلہ وسلم ٱَللّٰهُمَّ صَلِّ عَلٰى سَيِّدِنَا مُحَمَّدٍ طِبِّ الْقُلُوْبِ وَدَوَائِهَا، وَعَافِيَةِ الْاَبْدَانِ وَشِفَائِهَا، وَنُوْرِ الْاَبْصَارِ وَالبَصَائِرِ وَضِيَائِهَا، وَرَوْحِ الْاَرْوَاحِ وَغَذَائِهَا، وَعَلٰى اٰلِهِ وَصَحْبِهِ وَبَارِكْ وَسَلِّمْ، اَللَّهُمَّ صَلِّ عَلَى سَيِّدِنَا مُحَمَّد النَّبِيِّ الأُمِّيِّ جَزَى اللَّهُ عَنَّا مُحَمَّدً مَّا هُوَ اَهْلُه لا إِلَهَ إلاَّ اللهُ الحَلِيمُ الكَرِيمُ، سُبْحَانَ اللهِ رَبِّ الْعَرْشِ العَظِيمِ ، الحَمْدُ لِلهِ رَبِّ العَالَمِيْنَ ، أَسْأَلُكَ مُوجِبَاتِ رَحْمَتِكَ ، وَعَزَائِمَ مَغْفِرَتِكَ ، وَالْغَنِيمَةَ مِنْ كُلِّ بِرّ،ٍ وَالسَّلامَةَ مِنْ كُلِّ إِثْمٍ ،لاَ تَدَعْ لِيْ ذَنْباً إِلاَّ غَفَرْتَهُ، وَلاَ هَمَّاً إِلاَّ فَرَّجْتَهُ، وَلاَ حَاجَةً هِيَ لَكَ رِضاً إِلاَّ قَضَيتَهَا يَا أَرْحَمَ الرَّاحِمِيْنَ اللَّهُمَّ صَلِّ عَلَى مُحَمَّدٍ وَعَلَى أَزْوَاجِهِ وَذُرِّيَّتِهِ كَمَا صَلَّيْتَ عَلَى آلِ إِبْرَاهِيمَ وَبَارِكْ عَلَى مُحَمَّدٍ وَعَلَى أَزْوَاجِهِ وَذُرِّيَّتِهِ كَمَا بَارَكْتَ عَلَى آلِ إِبْرَاهِيمَ إِنَّكَ حَمِيدٌ مَجِيدٌ اَلْفَاتِحَة إِلَى رُوحِ سَيِّدِنَا رَسُولِ اللهِ مُحَمَّدِ بِنْ عَبْدِ اللهِ ﷺ وَآلِهِ وَأَصْحَابِهِ وَأَزْوَاجِهِ وَذُرِّيَّتِهِ، أَنَّ اللهَ يُعْلِي دَرَجَاتِهِمْ فِي الْجَنَّةِ وَ يَنْفَعُنَا بِأَسْرَارِهِمْ وَأَنْوَارِهِمْ وَعُلُومِهِمْ فِي الدِّينِ وَالدُّنْيَا وَالْآخِرَةِ وَيَجْعَلُنَا مِنْ حِزْبِهِمْ وَيَرْزُقُنَا مَحَبَّتَهُمْ وَيَتَوَفَّانَا عَلَى مِلَّتِهِمْ وَيَحْشُرُنَا فِي زُمْرَتِهِمْ، اَلْ اَلْفَاتِحَة إِلَى أَرْوَاحِ الْاَوْلِيَاءِ وَالشُّهَدَاءِ وَالصَّالِحِينَ وَالْاَئِمَّةِ الرَّاشِدِينَ، وَإِلَى أَرْوَاحِ وَالِدِينَا وَمَشَائِخِنَا وَذَوِي الْحُقُوقِ عَلَيْنَا وَعَلَيْهِمْ أَجْمَعِينَ، ثُمَّ إِلَى أَرْوَاحِ أَمْوَاتِ الْمُؤْمِنِينَ وَالْمُؤْمِنَاتِ وَالْمُسْلِمِينَ وَالْمُسْلِمَاتِ، أَنَّ اللهَ يَغْفِرُ لَهُمْ وَيَرْحَمُهُمْ وَيُعْلِي دَرَجَاتِهِمْ فِي الْجَنَّةِ وَيُعِيدُ عَلَيْنَا مِنْ أَسْرَارِهِمْ وَأَنْوَارِهِمْ وَعُلُومِهِمْ وَبَرَكَاتِهِمْ فِي الدِّينِ وَالدُّنْيَا وَالْآخِرَةِ، اَلْ اَلْفَاتِحَة بِالْقَبُولِ وَتَمَامِ كُلِّ سُولٍ وَمَأْمُولٍ وَصَلَاحِ الشَّأْنِ ظَاهِرًا وَبَاطِنًا فِي الدِّينِ وَالدُّنْيَا وَالْآخِرَةِ، دَافِعَةً لِكُلِّ شَرٍّ جَالِبَةً لِكُلِّ خَيْرٍ لَنَا وَلِوَالِدِينَا وَأَوْلَادِنَا وَأَحْبَابِنَا وَمَشَائِخِنَا فِي الدِّينِ مَعَ اللُّطْفِ وَالْعَافِيَةِ وَعَلَى نِيَّةِ أَنَّ اللهَ يُنَوِّرُ قُلُوبَنَا وَقَوَالِبَنَا مَعَ الْهُدَى وَالتُّقَى وَالْعَفَافِ وَالْغِنَى وَالْمَوْتِ عَلَى دِينِ الْإِسَلَامِ وَالْإِيمَانِ بِلَا مِحْنَةٍ وَلَا إِمْتِحَانٍ بِحَقِّ سَيِّدِ وَلَدِ عَدْنَانِ وَعَلَى كُلِّ نِيَّةٍ صَالِحَةٍ، وَإِلَى حَضْرَةِ النَّبيِّ مُحَمَّدٍ صَلَّى اللهُ عَلَيْهِ وَآلِهِ وَسَلَّمَ، اَلْفَاتِحَة اَلْفَاتِحَة إِلَى ارواح شريف الحسني وخاصة الروح القدس صَاحِبِ الرَّاتِبِ اَلْقُطْبِ رباني محبوب صبحاني هيكل الصمداني ،سلطان الرجالي حضرت مشايك صلاوات كیبریت احمر الغوث الأعظم ابو عبد الرزاق عبد القادر الجيلاني وَإِلَى حَضْرَةِ النَّبِيِّ إمام الأنبياءول المرسلين رحمة للعالمين مُحَمَّدٍ مصطفى صَلَّى اللهُ عَلَيْهِ وَسَلَّمَ، اَلْفَاتِحَة بِسْمِ اللَّهِ الرَّحْمَنِ الرَّحِيممدد مدد … اللهم صل وسلم وبارك على سيدنا محمد وعلى آل سيدنا محمدد مدد … اللهم صل وسلم وبارك على سيدنا محمد وعلى آل سيدنا محمد عدد كمال الله وكما يليق بكماله اللهم صل وسلم وبارك على سيدنا محمد وعلى اله وصحبه اجمعين عدد خلقه ورضا نفسه وزنه عرشه ومداد كلماته عدد ماكان وعدد مايكون وعدد الحركات والسكون الي يوم الدين Teach Love of Islam with Wisdom & Mercy" “بَشِّرُوا ولا تُنَفِّرُوا، يَسِّرُوا ولا تُعَسِّرُوا”, "Bashshirū wa-lā tunaffirū, yassirū wa-lā tu‘assirū", “Give people good tidings & don't make them run away; make things easy & don't make them difficult”, says our Holy Prophet ṣalALlāhu ‘alayhe wa-salim. He ﷺ says, "Make things easy & don't complicate them.” Complicating leads people to hatred & pushes them away. It pushes them away from religion. We shouldn't complicate it too much for them, because not everyone appreciates it. There are people who reached guidance later on. There are children. They are not used to it too. You must show the good & the bad in a nice way & ensure that they do it. Otherwise, when by Rude force, most of the time, it happens the other way. The opposite happens. People start to HATE ISLAM. They don't want to hear & want to avoid the rude preachers. Therefore, we must think through everything we do. We must look if we are doing right or we are doing wrong. That is why a Hadīth sharīf of Sayidil Ambia wal Mursaleen ﷺ says: “ تَفَكُّرَ سَاعَةٍ خَيْرٌ مِنْ عِبَادَةِ سَبْعِينَ سَنَةٍ”, “Tafakkur sā‘atin khayrun min ‘Ibaādati sab‘īeen sanah." Contemplating for 1 hour is better than worship for 70 years. On the Yaumil Qeeyamah,Sayadil Nisaa Alameen-Fatima Zehra رضي الله عنها Salaam Allah Alayha, KarmAllahu Wajha's Residence will be with Rasool-الله جل جلاله salAllahu Alayhe wa-Sallim in a White Dome under the Arshil Atheem of Allahu-Kareem. Hadruth Ameerul Momineen Omar Al-Farooq رضي الله عنه narrates that RasoolAllah salAllahu Alayhe wa-Sallim said: "Indeed Fatima,Ali,Hasan,& Husayn will live in a White dome in Jannathul Firdausay Ala. The Arshil Atheem of Allahu Rauf-ur-Raheem will be it's Roof (Ibn Asakir in Tarikh Dimishq al Kabir 14:61) "By Him who splits the grain & creates the soul, Al-Nabi al Ummi RasoolAllah ﷺ vowed unto me that none LOVES me but a believer & none HATES me but a hypocrite." -Sayidina Imam Ali KarmAllahu Wajhu رضي الله عنه Alayhee Salaat-Salaam Ref: Sahih Muslimللهم صلي وسلم وبارك على سيدنا محمد وعلى آل وصحبه وسلم* "The nourishment of the body is food, while the nourishment of the soul is to feed others."* [Imam Hadrath Ali Murtaza رضي الله عنه] "He who treads the path in search of knowledge, الله جل جلاله will make it easy for him a path to Jannah." Rasool-Allah (ﷺ) perfomed a SIJDAH in mud & water on the 21st of Ramadan, maybe that is the laylatil Qadr night. The 21st night of Ramadan also marks the Shahaduth of Imam Hadrath Ali عليه السلام Sayidina Sahibul Safe-ee wal Qadah Nashirul Ilm-ee wal Huda Mawlah Imam Ali KarmAllahu Wajhu عليه السلام said that once RasoolAllah ﷺ said to me, “First of all, You, Fatimahرضي الله عنها , Hasan & Husayn رضى الله عنهم ورضُوا عنهعليهم السلام will enter Jannathil-Firdause.” I asked, “O Messenger of الله جل جلاله ﷺ! Where will those who LOVE us be?” The Prophet ﷺ said, “They will be following you.” -Reported in al-Mustadrak May الله جل جلاله elevate their ranks & give us the strongest of LOVE & connections to Ali عليه السلام, an attachment which benefits us in this life & the next.إن شاء الله‎ Allahumma Ameen bi Jahi Taha Rasool ﷺAl Fatiha! {بِسْمِ اللَّهِ الرَّحْمَنِ الرَّحِيمِ * الْحَمْدُ لِلَّهِ رَبِّ الْعَالَمِينَ}إن الله وملائكته يصلون على النبي يا أيها الذين آمنوا صلوا عليه وسلموا تسليما﴾ اللهم صل وسلم على سيدنا و نبينا محمد وعلى Salawat الإسكندرية, is as precious as the Orange given to me by the الإسكندرية al'Iskandaria Police Officer- ضابط شرطة الإسكندرية. رحمه الله، ورفع درجته في الدين والدنيا، إن شاء الله آمين اَللَّهُمَّ صَلِّ عَلَى سَيِّدِنَا مُحَمَّدٍ السَّابِقِ لِلْخَلْقِ نُورُهُ وَرَحْمَةً لِلْعَالَمينَ ظُهُورُهُ عَدَدَ مَنْ مَضَى مِنْ خَلْقِكَ وَمَنْ بَقِيَ وَمَنْ سَعِدَ مِنْهُم وَمَنْ شَقِيَ صَلَاةً تَسْتَغْرِقُ الْعَدَّ وَتُحِيطُ بِالْحَدِّ صَلَاةً لَا غَايَةَ لَهَا وَلَا إِنْتِهَاء وَلَا أَمَدَ لَهَا وَلَا اِنْقِضَاءَ صَلَاةً دَائِمَةً بِدَوَامِكَ بَاقِيةً بِبَقَائِكَ وَعَلَى آلِهِ وَصَحْبِهِ وَسَلِّمْ تَسْلِيمًا مِثْلَ ذَلِكَ. اَللَّهُمَّ صَلِّ عَلَى مُحَمَّدٍ وَعَلَى آلِ مُحَمَّدٍ وَاَجْزِ مُحَمَّداً عَنَّا مَا هُوَ أَهْلُه ُاللَّهُمَّ صَلِّ عَلَى مُحَمَّدٍ وَعَلَى آلِ مُحَمَّدٍ عَدَدَ مَا عَلِمْتَ وَزِينَةَ مَا عَلِمْتَ و َمِلْءَ مَا عَلِمْتَ اللَّهُمَّ صَلِّ وَ سَلِّم وَ بَارِك عَلَى سَيِّدِنَا وَ مولَاناَ مُحَمَّدٍ وَ عَلَى كُلِّ نَبِيٍّ وَ عَلَى جِبرِيلَ وَ عَلَى كُلِّ مَلَكٍ وَ عَلَى اَبِي بَكْرٍ وَ عَلَى كُلِّ وَلِيٍّ للَّهُمَّ اجْعَلْ خَيْرَ زَمَانِيْ آخِرَهُ، وَخَيْرَ عَمَلِيْ خَوَاتِمَهُ، وَخَيْرَ أَيَّامِيْ يِوْمَ أَلقَاكَ “Ya الله جل جلاله, let the BEST of my lifetime be its ending. My BEST deed is that which I seal [my life with], & the BEST of my days,the day I meet YOU إن شاء الله‎ اللهم ادخلني جنة الفردوساَللّٰهُمَّ حَاسِبْنِيْ حِسَابًا يَّسِيْرًا Allahuma adkhilni Junuthil Firdausay Ala wa Haasibni Hisabay-Yaseera O Allah, Grant me The Highest Paradise & an easy Reckoning. The 17th of Ramadān marks the date of the passing away of the wife of the Best of Creation ‎ﷺ, the daughter of AfdalayBashr Baday Ambia, The Best in Mankind after the Prophets (Sayidinā Abū Bakr KarmAllahu Wajhu), the Mother of the Believers, who is among the finest female scholars in Islām – Sayidah 'Ā'isha al-Sidīqah رضي الله عنهاSalaam-Allah Alayha. It was on her Sweet lap the Messenger of Allāh ﷺ spent the final moments of his life. Sayidinā Jibrā'īl Alay Salaam once came to the Prophet ‎ﷺ with a Green silk cloth which had the image of Sayidā 'Ā'isha KarmAllah Wajha رضي الله عنها Salaam Allah Alayha on it, & said:“This is your wife in this world & the Hereafter.” Source:Sunan al-Tirmidhīرضى الله عنهم ورضُوا عنهMay Allāh sanctify her رضي الله عنها & us with her by these Mubarak Ayats of the Quran: :مطففين, وَمَا أَدْرَاكَ مَا عِلِّيُّونَ كِتَابٌ مَرْقُومٌ يَشْهَدُهُ الْمُقَرَّبُونَ إِنَّ الْأَبْرَارَ لَفِي نَعِيمٍ عَلَى الْأَرَائِكِ يَنْظُرُونَ تَعْرِفُ فِي وُجُوهِهِمْ نَضْرَةَ النَّعِيمِ يُسْقَوْنَ مِنْ رَحِيقٍ مَخْتُومٍ خِتَامُهُ مِسْكٌ ۚ وَفِي ذَٰلِكَ فَلْيَتَنَافَسِ الْمُتَنَافِسُونَ وَمِزَاجُهُ مِنْ تَسْنِيمٍ عَيْنًا يَشْرَبُ بِهَا الْمُقَرَّبُونَ with the Rosey Scents & Musk-Ataar-Oudh-Amber-Kafur,أَطْيَبُ الطِّيبِ الْمِسْكُ al-Misk (الْمِسْكُ) & elevate her status along with ours, with Drinks From The Hawd Al-Kawthar on Yaumil Hashr, إن شاء الله‎-talah-Ameen . Also Remember in your Fatiha the participants & the martyrs of Badr, on the 17th of Ramadān, In Sha Allah“ الله جل جلاله's Messenger (ﷺ) made a mention of a woman of Bunee Isra’eel who had filled her ring with musk, & musk is the most fragrant of the scents." ﷽ - الصــلوة والسلام‎ عليك‎ ‎يارسول‎ الله ﷺ Dua for Junnathil Firdausay Ala: اللهم إني اسألك الفردوس الأعلى من الجنة لي ولوالدي ومن أحبب من خلقك Ya الله جل جلاله I ask you for the highest point of al-Firdaus of Paradise for myself, my parents & those I LOVE of Your creation. Ummul Momineen Sayidah A’ishah رضي الله عنهاreported: I asked: “O Messenger of الله جل جلاله ﷺ If I realize its Layla-til Qadr (The Night of Power), what should I supplicate in it?” He ﷺ replied, “You should supplicate: *اللَّهُمَّ إِنَّكَ عَفُوٌّ تُحِبُّ الْعَفْوَ فَاعْفُ عَنِّي* Allahumma innaka `afuwun, tuhibbul-`afwa, fa`fu `anni (Ya الله جل جلاله, You are Most Forgiving, & You love forgiveness; so forgive me, اللهم أمين يارب العالمين بجاه سيد الأولين والأخرين سيدنا ومولانا محمد صل الله وسلم وبارك عليه وعلى أهل بيته الطيبين الطاهرينImam Al-Shafi’, Ya الله جل جلاله have Mercy upon him, beautifully recited this poem. Oh Blessed family of Al-Mustafa ﷺ, Of those whom I turn to, Of those whose love is my reliance, you are my intercessors on the Day of Judgement. Why should I be afraid when I trust you & have confidence in you? He who loves you will reside for Eternity in Jannuth, & your enemies will dwell for Eternity in a Blazing fire. Every Jannuth has a Jannuth. The Supreme Jannuth of all Jannuths is my Grandfather Rasool-الله جل جلاله-Muhammadصلى الله عليه وسلم ﷺ﷽ - الصــلوة والسلام‎ عليك‎ ‎يارسول‎ الله ﷺ Hadrath أبو أيوب الأنصاري رضي الله عنه reported: A Bedouin came toالأنبياءأَفْضَل‎‎ الأفضل RasoolALLAHﷺ صلى الله عليه وسلم(the Best of the Best Prophets), & said: “Ya RasoolALLAHصلى الله عليه وسلمﷺ, I love horses. Will there be horses in Jannuth?”RasoolALLAHصلى الله عليه وسلمﷺsaid, “If you enter Jannuth, you will be given a horse of rubies with 2 wings to mount, then it will fly with you wherever you wish.” One day RasoolAllah ﷺ asked Jibra-eel عليه السلام, “Have you ever travelled at full speed?” Jibra-eel عليه السلام said, “Yes, on 4 occasions.” RasoolAllah ﷺ asked, “What were the 4 occasions?” Jibra-eel عليه السلام said, “First time was when Ibrāheem عليه السلام was placed in Nimrud’s fire. At the time I was near the Arsh-Throne. الله جل جلاله ordered me to cool the fire. I left the Arsh & descended 7 heavens in time. Second time was when Ibrāheem عليه السلام was about to sacrifice his son Isma-eel عليه السلام in Mina. الله جل جلاله ordered me to replace his son with a lamb, before Ibrāheem عليه السلام struck with his knife.Third time was when, the brothers of Yusuf عليه السلام threw him into the well. الله جل جلاله ordered me to save Yusuf عليه السلام, I rushed & placed my wing underneath Yusuf عليه السلام before he reached the bottom of the well. The final time was when you, Ya Rasool-الله جل جلاله ﷺ, injured your tooth at the battle of Uhud. الله جل جلاله ordered me to stop your blood from reaching the ground, otherwise no plant or tree would grow, till the end of the world. Hearing this, I rushed & saved your blood with my wings.” ﷽ - الصــلوة والسلام‎ عليك‎ ‎يارسول‎ الله ﷺ Narrated by Ummul Momineen Aisha Sideeqa رضي الله عنها: *Whenever RasoolAllah ﷺ went to bed every night, he used to cup his hands together & blow over it after reciting Surat Al-Ikhlas, Surat Al-Falaq & Surat An-Nas, & then rub his hands over whatever parts of his body he was able to rub, starting with his head, face & front of his body. He used to do that thrice.[Sahih al-Bukhari]. These Ayats look BEST on a Muslim's Tomb &/or Laser Engraved Memorial Plaque: يَـٰٓأَيَّتُهَا ٱلنَّفْسُ ٱلْمُطْمَئِنَّةُ ٢٧ ٱرْجِعِىٓ إِلَىٰ رَبِّكِ رَاضِيَةًۭ مَّرْضِيَّةًۭ ٢٨ فَٱدْخُلِى فِى عِبَـٰدِى ٢٩ وَٱدْخُلِى جَنَّتِى ٣٠ دنیا میں کروڑوں کتابیں ہیں مگر الحَمدُ اللّٰہ قرآن پاک دُنیا کی سب سے اعلیٰ کتاب ہے All Praise is due to Allah, the Author of the Gracious Quran, the World's Best Book, which contains the Best Prophetic Duas Like That of Sayidina حذرت Ibraheem عَلَيْهِ ٱلصَّلَاةُ وَٱلسَّلَامُ Rabbi ij'al hadha al-Balada Aaminoww wajnubnee wabunee-ya an na’buda al-asnam. درود اکبر شریف صَلَوَات الشيخ الاكبر رَبِّ اجْعَلْ هٰذَا الْبَلَدَ اٰمِنًا وَّاجْنُبْنِيْ وَبَنِيَّ اَنْ نَّعْبُدَ الْاَصْنَامَ ۗ ابراهيم: ٣٥ “O Allah! May Thy Grace & Peace rest upon مصطفى سيدنا رسول الله صلى الله عليه وسلم حذرت مُحَمَّد عَلَيْهِ ٱلصَّلَاةُ وَٱلسَّلَامُ, our Master, the Prophet of Arabia of Quraish Tribe, of Hashmite Family of Mecca & Medina, who is the wearer of the Holy Cap, the one who ascended the Heavens & fought holy wars achieving boons & bounties, the one who has a Sacred place of Praise & who is in-charge of the حَوْضُ ٱلْكَوْثَرِ, the One who has excelled in supplication to “ﷲ”, our الرَّبّ Only. الشيخ الأكبر has disclosed a number of benefits of this صَلَوَات. It's the most sacred, accepted & appreciated صَلَوَات.
Salawat-Shayk Al-Akbar
Allahumma Sali Wa Sulim Ala Sayidina Muhammadinin Nabee-Yul Ummee-yul Arabe-eeyul Qurashee-yul Hashimee-yul Makhee-yul Madanee-yul Sahibit-Tajee Wal Mi'raajee Sahibis Sarayah Wal Atheye-ya Sahibil Maakamul Mahmoodul Hawdull Mawrudee Saahibis Sujudee Lir Rabbil Ma'bood,SallAllahu Alayhee wa Alihee wa salim
Just as the legendary Red Sulphur was believed by alchemists to turn base metal into pure gold, Salawatay-Kibryatul-Ahmer transforms the base & diseased heart into one of spiritual abundance, in Sha Allah
Sayidina RasoolAllah sullAllahwalayhee wa Salim said: "Then a green Rafraf (Divine Carrier) was laid for me. It's light was even greater than that of the sun. It's brilliance brightened my vision. I was seated on it & taken into the Heavens until I reached the Arsh of ALLAH.*[Madaarijun-Nubuwwah] Subhana allathee Asra bee AAabdihee laylan minaal Masjidil Haramee ilaal Masjidil-Aqsa allathee barakna hawlahu lee-Nuriyahu min Ayateena innahu huwas Samee-ul Baseer.
Murshidina RasoolAllah salAllahu 'Alayhee wa salim (Peace & blessings of Allah be upon him) said:Paradise has one hundred grades, each of which is as big as the distance between heaven & earth. The highest of them is Firdaus & the BEST of them is Firdaus. The Throne is above Firdaus & from it spring forth the rivers of Paradise. If you ask of ALLAH Subanahu-ta'Ala (Glorified & Exalted be He), ask Him for FIRDAUS [Sunan Ibn Majah]. The Body is Sharia, the Mind is Tareeka, the Heart is Marifa, the Soul is Haqeeqa. Our discipline is implanted in the love of ALLAHuWadood, in the love of Prophet SullAllahwalayheewaSalim, & in the love of Awlia-Allah. That is our Honor, & with that Honor, May ALLAH honor us with the Best of Muslim Wives, not just in Dreams, but also in Reality, in Sha ALLAH, Ameen
This Duniya is Beautiful when you are at peace with the Duniya Within You. So call people to do good & prohibit them from doing wrong. Amr bil Maroof Wan nahiy Ahnil Munkar.
When a Sufi stares at someone, during his sleep, his 3rd Eye sees his LOVERS in the Inner realm.
All Praise is due to ALLAH who has fullfilled my fantasies with a Beauty who I think is in fact the Lahori-Ayesha & another White Beauty (2 different Girls in 2 different Dreams). Whoever leaves their affairs to Allah, Allah will give them more than what they ever desired (2 LOVERS, in lieu 1). Mash-Allah La Howla wala Quwatta illa Billa-hil Aliyul Adheem!, "DIL KAY HE-JAABOW MAY" When you find yourself with the Beloved, embracing for one breath. In that moment you will find your true destiny. Alas, don't spoil this precious moment. Moments like this are very, very rare! - Mawlana Jalaluddeen Rumi (Rahmath-Allah Alay, Qaddas Allahu Sirrahu wa Nurrahu - May Allah's Mercy be upun him, sanctifying his Soul's secret & light) ALLAH is Most Gracious to His servants. He provides Sustenance with The Love of Women to whom He wills & HE is the Strongest of all Mighty Kings!
Patience isn't sitting & waiting, it's FORESEEING. It's looking at the THORN & seeing the ROSE, looking at the NIGHT & seeing the DAY. The LOVERS of ALLAH never run out of patience, for they know that TIME is needed for the CRESCENT MOON to become FULL.-Shams Al-Deen Tabrizi RahmuthAllah Alay Salaam, NafunAllahuBee we Be Barkitihee fee Darayn

Whoever Beautifies himself in the inside, Allah will Beautify him on the outside.-Hadruth AsadAllahu-Ghalib Ali bin Abu Talib KarmAllahu Wajhu Alay Salaat wa Salaam
We can't always find Lovers by searching for them, Blessed be Allah Al-Wadood, who finds for us the woman who bring Peace to the heart & joy to the Body.
Everyone sees the unseen in proportion to the clarity of their hearts, & that depends upon how much it is polished by DhikrAllah, whoever polished it more, sees more & the hidden becomes manifest to their souls. ''QALB AL-MU'MIN BAYT AR-RABB.The Heart of the believer is the House of the King of Kings: ALLAHU Malikul Mulkee Dhul Jalaalee wal Ikramee.'' Oh people! Indeed, I have left among you that which, if you hold fast to it, you shall not go astray: the Book of Allah & my Family, the People of my House. (Narrated Hadruth Jabir bin 'Abdullah R.A, -Hadith book of Tirmidhi)
The Most Beautiful Clothes that can dress a Woman are the
arms of the Man she Loves.
A Turkish couple's incredible wedding day gesture has won hearts all over. Fethullah & Esra Polat, invited as many as 4,000 Syrian refugees to eat & celebrate with them. May Allah make us follow their example, inSha-Allah. The Most Blessed NIKAH (marriage ceremony) Is The One With the Least Expense Spent On It.
May the unmarried be blessed with the spouses who will be the coolness of their eyes. May those getting married be granted bliss & success, joy & happiness. May those without children be blessed with offspring who will be the coolness of their eyes. This website is dedicated to my DREAMGIRL(Ayesha) &/or to whom my name was written next to yours 50,000 years before everything was created, in the Preserved Tablet(Al-Lohay Mafuz). May we meet in the most Beautiful way- the way most favoured by Allah who is the Best of Wedding Planners, in Sha Allah. Hadruth- Abu Hurayra RadeeAllahuAnhu stated that: Our Prophet the Lion of the Creation sullAllahwalayheewaSalim said, "A woman is married for four things, 1.her wealth, 2.her family status, 3.her beauty & 4.her religion. So you should marry the religious woman (otherwise) you will be a loser."
Nowadays we see many people spending a fortune on lavish weddings only to show off, but the simpler the marriage the more blessings Allah Subhaanho-toAlah will bestow on the marriage, In Sha Allah. When your connection with Allah is strong HE can make your connection with HIS Makhlook (Creation) even stronger & beautiful in a SuperNatural way even though the Shaytaani Muslim Mingle Marriage Sect of Canada may prefer to divide & separate by age groups, ruining the marriage chances of people who were living in POVERTY in their youth, to even consider marriage was unimaginable at that time. If they assisted muslims to follow a practical form of ISLAM, we wouldn't be tempted towards looking at Kafir Girls, less than half our age. The Same Age Group Bidat they have started is against the SUNNAH, therefore making the SUNNAH marriage, the hardest thing to accomplish. Fear Allah Subanaho-talah sincerely & repent you EventBrite-BIDUTEES!!!. May ALLAHuAzeezulWadood guide us to make the right choices when it comes to finding a life partner & therefore make it easy for all of us,
When Allah has selected you it doesn't matter who else has neglected or rejected you!
Allah's favors outweigh all Opposition
Have this faith, my Brothers/Sisters & keep working towards righteousness. It is never too late. May Allah guide us all.
Allahumma innaka Afuwwun tuhibbul Afwa fa Afu-ani, Ameen!
Allah,You are Pardoning & you love to pardon, so pardon me.

Forty Hadiths On Marriage By Mufti al-Kawthari & others are great to read.

There is a Rumor circulating that I don't listen to Qawalees, that's FALSE, I do. However there is a time & place to listen to them. CLICK TO HEAR

That's the Way it has to be,

Ayeshah Tujay Say Naraaz Nahee, Hayraan Ho May
mawlanafaizani.jpg
MAKE ISTIKIRAH FOR THE BEST

http://www.naseeb.com/journals/73-benefits-of-durood-shareef-192661

Ya Dhaal Jalaali wal Ikraam
mymelonhue.jpg
http://www.qadiriya.com/Nasheeds/Tarim%20nasheed/Ya%20daljalaali%20wal%20ikraam.mp3
Husbee Raabee Jal-ALLAH
al-baz.jpg
Ayesha BAAZ Rishtay Kabhee Khatum Nahee Hotay
The Joy of the Secrets in Abdul-Qadir's Mysterious Deeds (Bahjat al-Asrar fee ba'd Manaqib 'Abd al-Qadir) attributed to Nur al-Din 'Ali al-Shattanufi, has depicted my Grandfather as the ultimate channel of divine grace & helped the Qadiri order to spread far beyond the region of Baghdad.
Respect for my Grandfather, the Supreme Helping Hawk of ALLAH, BazALLAHU Ashab AlGhowthal Adham Abul Qadir Gaylaani AlHasani, is the same as showing respect for me, because he's the REAL SUPERMAN, the Sultan of Baghdad who in his previous life, lifted ALLAH's mercy offered to the creation "an-Nabi ar-Rahmah al-Mughdad", RasoolALLAHSullAllah Walahee wa Salim on to his own shoulders to bring our Prophet Muhammed SullALLAHwalahee wa Salim closer to ALLAHU AKBAR Himself, than the Buraq would even dare to, on Laylutil Meraaj is an amazing fact if correct. AlGhowth Al Adham Abdul Qadir Gaylaani Al-Hasani Shaynillah had the Footprints of RasoolAllah SullAllahwalahee wa Salim on his own blessed shoulders when he was born. Praise of the Sufi Saints should not be ignored, because to be looked upon by them is a blessing, an elixir of eternal life.
Develop your Spiritual connection with us by reciting Surah Fatiha: Al-Fatihah Ilaa Ruhee Sayidina wa Habeebina wa Barkatina Mawlaana Saahib-Aynil Kamalee Muhammed sull Allah wa Alihee wa Salim Al-Mukhtar wa Alay-Bayt-Al-Athaar wa Sahibee Akhyaar, thumma ilaa Ruhee Sayidina wa Habeebina
wa Barkateena wa Qudwateena wa Murshideena Sultaan
Muhyideen-Imamee, Qutabay Rubbaanee Haykalay Samdaanee Abdul Qadir Jilani Al-Hasani Shaynillah
wa Aswaajeehim wa Awlaadeehim wa Zureyateehim wa Usuleehim wa Furu'eehim
wa Dhawi'l Huquqee 'alayhim Ajma'een
annAllaha yaghfiru lahum wa yarhumu-hum
wa Yu'lee Darajaatihim fi'l Janahthil Firdosay Alah
wa Yanfa'unaa be-Asraarihim wa Anwaarihim
wa 'Ulumihim wa Nafahaatihim wa Imdaadeehim Madutteehim
fid Deenee wa'Dunya wa'l Akheerah
Al-Fatihata (Athaabakumullah) May Allah Reward you all!
(Recite Surah al-Fatihah) with these 14 names of Grandad, for our Thawab as follows:-
1. Sayid Muhiy-yudeen Ameer-Allah (Alayhir-Rahmah)
2. Sultaan Muhiy-yudeen Safe-Allah(Alayhir-Rahmah)
3. Ghawth al-Adham Muhiy-yudeen Qutob-Allah (Alayhir-Rahmah)
4. Khaajah Muhiy-yudeen Farman-Allah (Alayhir-Rahmah)
5. Makhdoom Muhiy-yudeen Burhan-Allah (Alayhir-Rahmah)
6. Valee-Awlia Muhiy-yudeen Aman-Allah (Alayhir-Rahmah)
7. Faqeer-Badshah Muhiy-yudeen Shahid-Allah (Alayhir-Rahmah)
8. Darvaysh-Shaykh Muhiy-yudeen Ayat-Allah (Alayhir-Rahmah)
9. Mawlana Muhiy-yudeen Noor-Allah (Alayhir-Rahmah)
10. Miskeen Muhiy-yudeen Qudoos-Allah (Alayhir-Rahmah)
11. Khaleel Muhiy-yudeen Arsh-Allah (Alayhir-Rahmah)
12. Baba Abdul Qadir Muhiy-yudeen Ara-Allah (Alayhir-Rahmah)
13. SayidisSadaat Muhiy-yudeen Baaz-Allah (Alayhir-Rahmah)
14. Dustkeer Muhiy-yudeen Mehboob-Allah (Alayhir-Rahma)
~ Na'ibay Muhiy'yud'deen Sayidina Safe-udeen , in Sha ALLAH
The Incident of Celestial Beings
One day Sultanil Faqr Tajudeen Abu Bakr Abdur-Razzaq KarmAllahu Wajhu Alay Salaat wa Salaam was present in the assembly of his father (The Supreme Helper=Ghowth Al Adham). Some mysterious & invisible beings were seen flying in sky, he saw them with fear but Ghowth-al-Adham told him not to worry as he was one of them.
Hadhruth Abu Zura'a Zahir Bin Al-Muqqadas Al-Dari is reported to have said :"Today, a few such people are also present here who live across the mount-Jabalay Qaaf Qudas, (Known in English as the Mysterious Emerald Mountain) their foot steps are in the air, their cloaks & the crowns of love of Allah on their heads are burning due to the extreme fire of Divine passion." Hadruth Sultanil Faqr Tajudeen Abu Bakr Abdur Razzaq was sitting close to the chair of his Blessed father Ghowth Al-Adham, listening to his words. Then the son of Gowth Al-Adham rose his head & gazed at the sky, in a moment his cloak, & turban started burning causing him to faint.
Gowth AlAdham Abdul Qadir Gaylaani KarmAllahu Wajhu then rose up & put the fire out with his own hands saying "Oh Abdur Razzaq, you are also one of them". Hadruth Abu Zura'a says that after the sermon I asked Sultanil Faqr Tajudeen Abu Bakr Abdur Razzaq about the incident. He explained that when he gazed at the sky he saw some celestial spiritual people in the air whose cloaks & turbans were blazing with the extreme fire of Divine passion & they were circling & dancing in the air, they were thundering like clouds with the ache of Divine love. Seeing them he also felt the same". (Half an hour after uploading the Madutt Ya ALLAH Video, the Smoke Detector activated by itself in the apartment I'm renting, making the same noise as it would when a Fire happens, but there was no fire in my apartment, maybe the Spiritual Beings of Jabalay Qaf came to visit me again, it's in their Honor I named this Website: EmeraldMountain, Tripod.com is paying the Bill for me to use their Domain for FREE at the moment)
Dr.Allama Iqbal's Poetic Dua
Koi urooj de na zawaal de,
Mujhe sirf itna kamaal de,
Mujhe apni raah me daal de,
ki zamaana meri misaal de,
Teri rahmaton ka nuzool ho,
Mujhe mehnato ka sila mile,
Mujhe maal o zar ki hawas na ho,
Mujhe bas tu rizq e halaal de,
Mere zahen me teri fikr ho,
Meri saas me tera zikr ho,
Tera khauf meri nijaat ho,
Sabhi khauf dil se nikaal de,
Teri baargaah me Aye Khuda,
Meri roz o shab hai yehi dua,
Tu Raheem hai Tu Kareem hai,
Mujhe Mush-kilown se nikaal de,
Aameen Ya Rabbil Alahmeen
Religion & Spirituality, taken from Pearls of Rumi
A learned man was once asked to explain the difference between Religion & Spirituality. His response was profound:
___ Religion is not just one, there are many.
* Spirituality is one.
___ Religion is for those who sleep.
* Spirituality is for those who are awake.
___ Religion is for those who need someone to tell them what to do and want to be guided.
* Spirituality is for those who pay attention to their inner voice.
___ Religion has a set of dogmatic rules.
* Spirituality invites us to reason about everything, to question everything.
____ Religion threatens and frightens.
* Spirituality gives inner peace.
___ Religion speaks of sin and guilt.
* Spirituality says, "learn from an error".
___ Religion represses everything which is false.
* Spirituality transcends everything, it brings you closer to your truth!
___ Religion speaks of a God; It is not God.
* Spirituality is everything and therefore, it is in God.
___ Religion invents.
* Spirituality finds.
___ Religion does not tolerate any question.
* Spirituality questions everything.
___ Religion is human. It is an organization with rules made by men.
* Spirituality is Divine, without human rules.
___ Religion is the cause of divisions
* Spirituality unites
___ Religion is looking for you to believe.
* Spirituality you have to look for it to believe.
____ Religion follows the concepts of a sacred book.
* Spirituality seeks the sacred in all books.
___ Religion feeds on fear.
* Spirituality feeds on trust and faith.
___ Religion lives in thought.
* Spirituality lives in Inner Consciousness
___ Religion deals with performing rituals.
* Spirituality has to do with the Inner Self.
____ Religion feeds the ego.
* Spirituality drives to transcend beyond.
____ Religion makes us renounce the world to follow a God.
* Spirituality makes us live in God, without renouncing our existing lives.
___ Religion is a cult.
* Spirituality is inner meditation.
___ Religion fills us with dreams of glory in paradise.
* Spirituality makes us live the glory and paradise on earth.
____ Religion lives in the past and in the future.
* Spirituality lives in the present
____ Religion creates cloisters in our memory.
* Spirituality liberates our Consciousness
___ Religion makes us believe in eternal life.
* Spirituality makes us aware of Eternal Life.
___ Religion promises life after death.
* Spirituality is to find God in our interior during the current life before death.
We are not human beings, who go through a spiritual experience.
We are spiritual beings, who go through a human experience.
Benefits of the Recitation of the Quran
ismallah.jpg
https://www.al-islam.org/fawaid-e-quran-sayyid-mustafa-musawi/benefits-recitation-chapters-holy-qura

By the Karamah of ALLAH-RAKAH

combined with the Barakah of Ya Nabee Salaam Alaykah

Phir Na Hoona Judah, Ya Wada Rahah

In Sha ALLAH

Aapkay CheRaY SaY
myattempt.jpg
Out of All woman, I lOVE AYESHA'S FACE

Novotel Kee CALI

Aur HINDU Putah, Ka Calah Dundah!!!

In the 8th century, Raja Dahir kidnapped a young Muslim girl & brutally tortured her every day. She was imprisoned & unable to escape, but she was able to send a letter to the Bunuh Ummayah-Muslim leader at that time to inform about what happened to her.

The leader then decided to send Bunuh Ummayah's finest man at that time, Muhammad bin Qasim NafunAllahuBe to take action, so he prepared his force & decided to attack India because of that victimized girl. Along with the army, he attacked a port in Sindh, captured it successfully marched towards the North & also captured many other regions.

Raja Dahir was eventually killed in the battle, & the Muslims beheaded him & sent his head back to Damascus.

Muhammed bin Qasim entered Sindh, rescued the Muslim girl along with all the Muslim prisoners who were captured alongside her. Hadruth Muhammad bin Qasim Alay Salaat wa Salaam is a person that many people from the Indian Subcontinent are quite familiar with as he is the individual who is responsible for why more than 800 million people who are Muslims today!

The conquest that started on a plea of a single girl resulted in Victory for Muslims. A lot of resources were used to raid into India, yet all was done on a single call of an Arab Muslim girl captured thousand miles far away from Arabia. Hadruth Muhammad Bin Qasim was known by the Laqab 'Imad ad-Deen.' He was a military commander of the 'Umayyad Caliphate' & led the Muslim Conquest of Multan & Sindh from the last Hindu ruler Raja Dahir in a conflict with Alor. He was the 1'st Muslim to capture Hindu regions successfully & started the early Muslim Rule.

I know some Hindus & Sikhs may have a Grudge with AlamGeer Aurangzabe, but from my research, he may have saved the chastity of a Hindu girl from Khan, his Corrupt Polygamous Governor in Banaras-Varanasi & had him killed by Elephants.
GreenMountain School
southeastisthecorrectqiblah.jpg

Anas ibn Malik R.A reported: The Prophet ﷺ said, “Whoever Allah provides with a righteous wife, Allah has assisted him in half of his religion. Let him fear Allah regarding the second half. ✨Al-Mu’jam al-Awsat

Close your eyes. Fall in Love.
yaali.jpg
Stay there
Alhamdullilah. According to Sister Manahil Ali Khan
Her Sister in Islam, made history!
The world's first munaqabah/niqabi student to be admitted to the University of Oxford in the University of Oxford's 900+ year history, a British Pakistani sister, graduates with a Distinction in the Bachelor of Civil Law (BCL) Master's degree - one of Oxford's most prestigious degrees.
An inspiration to Muslims worldwide that one can excel in both Deen & Dunya without compromising one's morals & Principles, like me (I shaved my beard,for a chance to earn a better income in Modelling. In an attempt To Get Rich or Die Trying). All Wealth & Success Belongs to Allah, the Exalted, Free of All Wants & Needs!!!

The association with the pious & godly persons is better even than doing a good deed, & the association with ungodly & vicious people is worse than doing an evil act. http://emeraldmountain.tripod.com

Assalamwalaycum, Peace be Upon You. In 1983. Hudruth- Syed Mubarak Ali Shah Gilani Raheemullah Alaih Salaat wa Salaam, NafunAllahu-bihee wa Be Aloomihee wa Be Barkatihee, published his translation of the Rauza-tus-Safa, an influential 15th Century history on the origins of Islam. I advise you to read it after listening to my Nasheeds: https://www.youtube.com/watch?v=p82Dwl0EBLU&t=28s I've made some of my own edits on his book articles, see my website for more details: emeraldmountain.tripod.com/islam Human beings can be made to do things against their will. They can be made to commit crimes. They can made to go & kill people. All your missiles, All your rockets, & the Drones that go up with electronics, can be damaged, influenced, & misdirected through the agencies of Jinn beings

Hasbee Rabee JalAllah
yamalikulmulk.jpg
ALLAH is Sufficient for me in all my Affairs!

I READ THIS SALAAM GOING TO MADINA SHAREEF
yashafeealwara.jpg
http://www.healingtheeye.com/10_essentials/10_Essentials_Improving_Eyesight_ep.pdf

Click on this photo to hear Shia-Sunni Debate
holynajef.jpg
https://www.youtube.com/watch?v=5NbGpm_PzHI

Abdullah ibn Masood (RadeeAllhu Anhu), stated that the Prophet (SullAllahu alayhee wa-sallam) said: Indeed, Islam began as something strange, & it will return to being strange just as it began, so glad tidings of paradise be for the strangers.

Click on this Photo to go to my Original Site
psx_20180105_234028.jpg
https://emeraldmountain.tripod.com/

goldeidreeseetaheel.jpg

Click to watch the Youtube Video on Taveez,
meandmyrelatives.jpg
This is a old picture of me & my relatives

ihopethekalimahiswrittenonme.jpg

12th of Ramadaan is our Grandfather's HolyBirthday
almuthana.jpg
17th is his Death Anniversary, Recite Fatihah for him.
Recite Fatiha for Sayidah NAFEESA SalaamAllahAlaya
limb.jpg
Luckily for me, I've made her Ziarat in Misr
بِسْمِ اللَّهِ الرَّحْمَنِ الرَّحِيم

سَبِّحِ ٱسْمَ رَبِّكَ ٱلْأَعْلَى ١ ٱلَّذِى خَلَقَ فَسَوَّىٰ ٢ وَٱلَّذِى قَدَّرَ فَهَدَىٰ ٣ اللهم بحق لا إلٰه إلَّا اللهُ مُحَمَّدٌ رَسولُ اللهِ في كُلِ لَمْحَةٍ ونَفَسٍ عَدَدَ ما وَسِعهُ عِلمُ اللهِ بنور وجهك العظيم لرسول الله الكريمي صلى الله عليه وسلم صدركهب لنا منك مغفرة تشرح بها صدورنا وتضع بها اوزارنا وترفع لنا بها ذكرنا وتيسر لنا بها أمرنا و تنزه بها افكارنا و تقدس بها اسرارنا و تكشف بها ضرنا وترفع بها قدرنا وتجبر بها كسرنا و تغني بها فقرنا و تقضي بها حوائجنا انك على كل شيء قدير يا واسع يا حليم ياذا الفضل العظيم اللهم صل على سيدنا محمد الوصف والوحي والرسالة والحكمة النور خير الخلق حبيب الحق محمدون سيد الكونيني والثقلين، والفارقيني من عربو ومن عجمي وعلى اله وصحبه والأفضل في ذريته وسلم . مولى يا سلّي وسليم دعيمان، آبادان على حبيبك خيري خلقي كليهيمي Family Tree of your Murshid, Sultanil Ashiqeen, Sayidina Safe-udeen Ma’sha’Allah ماشاء اللہ لاقوۃ الا باللہ

I was named after Hadruth Safe-uDeen Yahya Al-Hamavi Ash-Shamee, NafunAllahu Bee (My Maternal Family side claim to be his descendants, however Imam Jilani Al-Hasani  of Hama-Shareef in Syria, has refuted that claim upon inspection of our Maternal-Sijra-)  

Don't get upset maternal cousins, I'm just typing this to verify the truth,. Read the Salawat listed below if your getting angered by my typing, before you read about the live conversation I had with a brilliant student of Al-Azher in 1998, Cairo, Misr.

 

Salat Al-Fatih is held in particular esteem with the Tijaniyya Order. In English, it goes like this:-
O God bless our Master Muhammad (pbuh) who opened what had been closed, & who is the Seal of what had gone before, he who makes the Truth Victorious by the Truth, the guide to thy straight path,& bless his household as is the due of his immense position & grandeur.

Allahumma salli ' wa sallim wa baarik ala Sayidina Muhammadil
nil-Fatihi lima Ughliqa wal khatimi lima sabaqa wan-naa-siril-haqqi
bil-haqqi wal-hadi ila Sirati-kal-mustaqima sal-lal-lahu 'alayhi
wa 'ala alihi wa-ashaabihi haqqa qadrihi wa-miq-darihil-'azeem.


When I met Mr. Jilani AlHasani in Cairo, I showed him our mother's Sijra(Family Tree.)
He told me that Hadrath Syed Shahabuddeen Al-Hamavi RahmuthAllah Alay, had only one son, his name is Hadruth Syed Abdullah Basit Al Hamavi RahmuthALLAH Alay, he had only two sons, Ahmed AlHamawi, and Abdullah.
According to him, Ahmed AlHamawi died swimming in a river at a small age and his only other blood-brother, Abdullah died of a sickness.(Recite AlFatiha for them, -Hadruth Qutubudeen(Our Maternal Grand-dad) and all of the other people listed on our Materanal Sijra after Hadrath Syed Shahabuddean Al-Hamavi RahmuthAllah Alaih are JUST MUHIBEEN, this is according to my friend, Jilani AlHasani of Hama Shareef-SHAM, now known as Syria, However ALLAHUALIM if he's the one INCORRECT.

He told me the source for his Sijra knowledge is from the Arabic book, titled "Kaalidul Jawaahir fee Manaqib Shaykh Abdul Qadir"Assalamwalaycum, I read in the English Turjumah of Qala-id ul Jawahir Fi Manaqib GhowthayAdham Hadrath Shaykh Abdul Qadir Jilani, قلائد الجواہر فی مناقب غوث اعظم حضرت سیدنا شیخ عبد القادر جیلانی.

I really hope that our Mother's side get in touch with there friends or relatives in Hama Shareef, Syria,
preferably they can provide them and us with additional details. 

If you have any detailed information on who really is Syed Qutubudean AlHamavi?,  Is he REALLY the son of Shahabuddean AlHamavi Al-Jilani Al-Hasani, feel free to forward it to me, so I can continue further with this investigation.

Your more than welecome to investigate and determine for yourself, if you deem to know if our maternal Lineage is truly, the truth(
HAQQ), really from the bloodline of Ghawth al-Adham.

Salaams with Adab from Yours,
     True-Ali Sayidina Safe-uDeen Ali Khan AlHasani,

 Please read Al-Qalaaid Al-Jawahir for more details on the respected grandsons of Ghawthul Adham!:

Product Details

Necklaces of Gems (Qada'id Al-Jawahir): A Biography of Shaykh 'Abd Al-Qadir Al-Jilani by Shaykh Muhammad Ibn Yahya Al-Tadifi, & Muhtar Holland (Paperback - Sep 1995

My Paternal Lineage is as Follows, MashALLAH

Mohammed Mustafah SalAllahwalahee wa Alihee Wa Sahibee Wa Salim

1. اللهم صل وسلم وبارك على سيدنا محمد الاصل الذى تفرع منه جميع الاصول ورضى الله تعالى وتبارك على الامام المجدد وخاتم الوراث المحمديين AsadAllāhuGhalib أَسَدُ ٱلله Ali bin Abu Talib KarmAllahu Wajho Alay Salaam & Juduttee Sayedil Nisaa-Alameen Fatimah Zehraرضي الله عنهاSalaamAllah Alayha رحمها الله واسكنها فسيح جناته اللهم ارحم جميع موتى المسلمين

Abu Dawood Hadith Book 36, Number 4276A:

Narrated AsadAllahu-Ghalib Ali ibn AbuTalib, KarmAllahu Wajho Alaih
Salaam:

AbuIshaq told that Maula Ali alay Salaam looked at his son al-Hasan Alay Salaam & said: This son of mine is a Sayid (chief) as named by the Prophet (peace_be_upon_him), & from his loins will come forth a man who will be called by the name of your Prophet (peace_be_upon_him) & resemble him in conduct but not in appearance. He then mentioned the story about his filling the earth with justice.

2.Imamay Adhaam-Jadil Ghawth Al-Adhaam Abu Muhammed Sayidina Hasan Al-Mujtaba alay Salaatu wa Salaam-KarmALLAHU wajhu RahmuthALLAH Alay NafunAllahuBee (His wife our Blessed Grandmother is Khawla رضي الله عنها , the Chieftain of the Banu Fazara,Salaam Allah Alayha)

3. Sayidina Hasan Al-Muthanna Alay Salaam (His wife is Fatimaرضي الله عنها bintay Sultaan Al-Karbalah Imam Husayn Alay Salaam)

4. Sayidina Abdullah Al-Madh-Al-Mujall Al-Kamil (Also the Father of Mawlá Idrīs Al-Maghribee &,Muḥammad al-Nafs al-Zakīyya محمد بن عبد الله بن الحسن بن الحسن بن علي الملقَّب النفس الزكية,-The Pure Soul Grandfather of Sidi Ahmeday Tijani Alay Salaam-Raheemullah NafunAllahuBee) 5.Imam Sayidina Shareef Musa Al-Jaun ibn Abdullah Al-Kamil KarmAllahu Wajhu NafunAllahubee: الشريف موسى الجون Birthdate:estimated between 535 & 535 Birthplace:Mecca, Makkah Province, Saudi Arabia Son of Abdullah Al-Mahd Al-Kamil & Hindun رضي الله عنها The Father of 6.Sayidina Abdullah al-Rida ibn Musa ibn Abdullah was born in about 0772. He is the son of Musa ibnay Abdullah al-Hasani & a direct Ancestor of the Sufi master Shaykh Abd al-Qadir al-Jilani Alay Salaat wa Salaam. 7.Sayidina Musah 8.Sayidina Dawood

9.Sayidina Muhammed

10.Sayidina Yahya Az-Zahid

11.  Sayidina Abi Abdullah Az-Zahid

#12.Sayidina Abu Saleh Musah Jung Dosti &#12. Mother Ummul Khayr Ammat-Al-Jabbar-Fatima رضي الله عنها bintay #11.Shaykh Abdullah Sawmiy Al-Hussaini Az-Zahid NafunAllaho Bee #13. Sayidina Ghowth al-Adham Muhyideen Abdul Qadir Al-Jilani-Gaylaani-Kaylaani AlHasani KarmAllahu Wajho Alay SalaatwaSalaam NafunAllahuBee Ma’sha’Allah ماشاء اللہ لاقوۃ الا باللہ السلام عليك يا مير میران پیر پیران غوث الاعظم غوث محی الدین الجیلانی البغدادی رضي الله تعالى عنه Ma’sha’Allah ماشاء اللہ لاقوۃ الا باللہMy #14.Ancestor{Is the Son of the Hawk of Allah-BazAllahu Ashab QutabalAqtab-Ghowthal Thaqlane-GhowthAl Adham}-Sultanil Faqr Tajudeen Abu Bakr Abdur Razaqq Gaylaani AlHasani KarmAllahu-Wajhu Alay Salaat wa SALAAM,NafunAllahuBee (I regret not visiting his Blessed Tomb in Baghdad. Maybe in the Future ALLAHuMalikulMulk Be Ghayree Hesaab Shall give me the Wealth to make a Masjid where Hadruth Abdur Razzaq Gaylaani Alay Salaat wa Salaam NufunAllahuBee wa Be Aloomihee wa BeBarkatihee,is buried in Sha Allah, next to Imam Ahmed bin Hambal Alay Salaam,under the bridge, where the Tigris river can sometimes overflow, therefore it isn't visited by many at the moment. I've heard the Iraqi Government has also forbidden visitors to take photos of his Blessed Mazhar-Tomb. I look forward to CHANGE that in the Future, in SHA ALLAH. Make Dua that ALLAHU DHUL JALAALEE wal IKRAAMI, makes it a possibility, because HE has POWER over ALL THINGS, HUWA KULLI SHAY-IN QADEER. In Sha ALLAHutalah AMEEN) 15.Sayidina Abu Salih Naseer Al-Baghdaadi 16.Sayidina Abu Naseer Muhammad ibnay Abu Saleh Naseer Al Bagdaadi

17.  Sayidina Zahir-uDean Ahmed Abu Saud Al-Baghdadi

18.  Sayidina Abu Mohammed Hasan Al-Baghdadi, his blood brother was  Hadruth Shaykh Sayyid Abu Zakaria Safe-uDeen Yahya Al-Hamavi RahmuthALLAH Alay wa Salaatu wa Salaam,NafunAllahubee (the Man or Maternal Grand-dad I was named After!) Mash-ALLAH La Howla wala Quwwata illa Billah

19. Sayidina Ali Sayeed Mohammed Baghdadi

20. Sayidina Abu Ali Al-Izzat Ali

21. Sayidina Abu Mohammed Musah

22. Sayidina Hasan Khashaf ullah Hassan

23. Sayidina Ahmed Jaleel Al-Maghribee

24. Sayidina Abul Fattah Hussain

25. Sayidina Abul Qasim

26.  Sayidina Mohammed Ahmed

27. Sayidina Moizuddean

28.  Sayidina Muhyideen

29.  Sayidina Abdul Kareem

30.  Sayidina Ibraheem

31. Sayidina Zainul Abideen

32.  Sayidina Mohammed Sadiqul Qadree

33.  Sayidina Shah Mohammed Bada

34. Hardoom-Mulkay Dakhan wa Khademe Harmain Sharfain Syed Qutubudeen Sajada Nasheen (who was promoted to Prime Minister of Alim Gir Aurangzabe the son of Shah Jahaan & Mumtaz Mahal, Honorably by the Ottomon Empire during his visit to Makkah Al-Mukarahmah.) This father of ours, was also given the Key to the Kabah Shareef

35. Sayidina Shah Mohammed Khan Bhadur-Saderusudur

36. Sayidina Jaah Mohammed Khan Bhadur

37. Sayidina Akbar Ali Khan Bhadur

38. Sayidina Shamsuddean Ali Khan Bhadur

39. Sayidina Qutubudean Ali Khan

40. Sayidina Abdul Ali Khan

41. Syed Akbar Ali Khan ( his wife, our Grandmother- NooriNisah  Begum is a daughter of the sister of my maternal grandmother MajeedunNisah,who is the mother of Shaykul Islam Maulana Badshah Hussayni NafunAllahubee

42.  Syed Gawthuddean Ali Khan-"Subhaney Nawab"

43. Saydina Kasimuddeen Ali Khan

44. Your futuristic - future Murshid, in Sha ALLAH " Khajah Mehboob-Allah-Sultanal Awlia HabeebALLAH-Naeebay RasoolALLAH- Muqqadamis Saliheen- Sultaanil Ashiqeen -Sayidina Safe-uDeen, a Servant of ALLAH Malikee-YaumiDeen" a child of love, from the love of

SAYYID-US-SADAT QUTUB-UL-WUJOOD, RA-EASE-UL-MAHBOOBEEN, QUTBAL-AQTAB,  GAWTH-AL-AZAM  GHAWTHA-THAQLAIN, BAZ-ALLAHU-ASHAB MEHBOOBAY SUBHAANEE QUTUBAY RABBANEE SULTAANAL REE-JAALI ibnay MUSAH ABU SALIH JUNG DOSTI ALHASANI QUDDUS-ALLAHU-SIRRAH WA NAVIR DEYARAHOO ALAIH  SALAATU WA SALAAM

MY BELOVED GHAWTH AZAM IS A SUFI MASTER WHO IS LIKE THE SON OF RASOOL-ALLAH SALAH WALAH MUHAMMED SALL ALLAH WALAHEE WA SALIM IN SHARIAT, TARIQAT, HAQEEQAT AND MARAFIT( IRFAN OF ALLAH).

May ALLAH Asavajal enlighten the Mazhar and exalt the Maqaam of my Father Sultanil Rejaaly Muhyideen Abdul Qadir Jilani,  the
Son of Al Saiyed Abu Saleh Musa Jung Dosti,
Son of Al Saiyed Abdullah Al-Jiyeli,
Son of Al Saiyed Yahya Al-Zahid,
Son of Al Saiyed Muhammad,
Son of Al Saiyed Dawood,
Son of Al Saiyed Musa thani,
Son of Al Saiyed Abdullah,
Son of Al Saiyed Musah-Al-Jawn,
Son of Al Saiyed Abdullah Al-Madh-Al-Mujall,
Son of Al Saiyed Hassan Al-Muthana.

Son of Abu Muhammed Hasan Al-Mujtabah alaih Salaatu wa Salaam
Son of Sahibay Safey Wal Qadah Nashiril Ilmee Wal Huda, Maulah Ali KarmAllahu Wajhoo Alaih Salautu wa Salam and Sayidil Nisaa- Fatimah Zehra bint
Sayidil Rejaalee Bahril Kamilee Muhammed Mustafa SalAllahwalahee wa Aalehee wa  Salim tasleeman Katheran Katheera!
Son of Abi Talib Son of Abdul Mutalib,
Son of Hashim Son of Abdul Munaf 
Son of Qassay Son of Kilab
Son of Murrahta bni Kaabi, 
bni Luayyi bni Ghalib,
Son of Qahr Son of Malik
Son of An-Nadr Son of Kihanna,
Son of Khuzima Son of Mudrika,
Son of Ilyas Son of Mudar,
Son of Nadhaar Son of Maad,
Son of Adnaan Son of Owo,
Son of Own Son of Hameesaa,
Son of Jumal Son of Nibt,
Son of Kezar Son of Hadruth Ismail Zahbee-Allah alaih Salatu-Wa-Salaam,
Son of Hadruth Ibraheem Alaih Salaatu-Salaam
Son of Azhar Son of Qasir,
Son of Sharigh Son of Arghoot,
Son of Faligh Son of Shalikh,
Son of Keenan Son of Arpachshad
Son of Shaam Son of Hudruth Nuh Alaih Salaatu wa Salam,(Imam Ahmad bn Hambal RahmuthAllah Alay narrated from the route of Samurah, the son of Jundub that our Prophet SullAllahwalaheewa Salim said, “Shaam is the forefather of the Arabs, Ham is the forefather of the Abyssinians, & Yafith is the forefather of the first Romans (Greeks).”
Son of Yardd Son of Idris Alaih Salaatu wa Salam
Son of Mehmaial Son of Keenan,
Son of Anosh Son of Sheeth Alaih Salatu wa Salam,
Abu-l Bashir (Father of Mankind) Hadruth Adam Alaih Salatu Wa Salaam and Ummuh Hawah Alaih Salatu wa Salaam (Eve)
, who were created from Dust, dust from Earth; Earth from Foam, foam from Waves, Omnipotence, which from WILL, and WILL from the Infinite Knowledge of ALLAH.

ghauthalazmasdargahlookingbeautifull.jpg

Taveez isn't Shirk
mypoem.jpg
Click on this photo to hear a Dua on YOUTUBE.COM
abughadanafunallahube.jpg
Allahumma Ajarna min ZumHareeree Jahannum

qadirashadilahtareqahchain.jpg

sayingofhadruthomarr.aonsalaat.jpg

 
Thank you for taking action to bring justice for rape victims.

Send the email below to friends and family, and post this link on your Facebook wall.

http://www.avaaz.org/en/forced_to_marry_her_rapist_b/?tta
16 year-old Amina Filali, raped, beaten and forced to wed her rapist, killed herself — the only way she saw to escape the trap set for her by her rapist and Moroccan law. We’ve joined Moroccan activists, campaigning for years to repeal this provision, and now victory is within reach. This week, one last vote could make it happen.
 

Article 475 in Morocco’s penal code allows a rapist to avoid prosecution and a long prison sentence by marrying his victim if she is a minor. It’s any rape survivor’s worst nightmare, and for Amina, it came true. But now, after hundreds of thousands of us helped to push Parliament, a vote to repeal the provision is within our grasp. If it’s called, insiders say the repeal is certain to pass. We just need one final push to get it to the table.
 

Right now, there is almost no news coverage and no pressure on legislators to do the right thing. When our call is 1 million strong, we’ll place ads in the newspapers that MPs read and stand with Moroccan activists outside of Parliament with a sea of pink balloons representing the massive global response. Let’s honour Amina's memory by ensuring her tragedy is never repeated. Click below to join now:

http://www.avaaz.org/en/forced_to_marry_her_rapist_f/?bteyLab&v=33981

When Amina was brutally raped, her family reported it to officials in their town of Larache. Instead of prosecuting the rapist, the court allowed him the option of marrying his victim— and Amina’s family agreed to the proposal. After her suicide, Avaaz members stood with Amina’s heartbroken parents and Moroccan activists to deliver nearly 800.000 voices for reform, making international headlines. The government promised change but nothing happened — until now.

Article 475 isn’t the only challenge to women’s rights in Morocco, but has become a striking symbol of what’s wrong. The government has promised to pass comprehensive legislation to stop violence against women since 2006 and to strike down Article 475, but nothing changed while girls’ lives were destroyed.
 
Finally things are moving in the right direction, with the Justice Committee striking down the most problematic part of the article and passing the bill on to the entire Lower Chamber for a vote — if this issue is called, it’s very likely that Morocco will have a new law and Amina will see a kind of justice. This vote is the first crucial step to the real reform that women’s groups in Morocco have long fought for. Let’s seal the deal on 475 to demand that laws should protect, not trample on women’s rights:

http://www.avaaz.org/en/forced_to_marry_her_rapist_f/?bteyLab&v=33981

From Afghanistan and India to Japan and Kenya, Avaaz members use our collective power to join with people around the globe to fight for women’s rights — today, let’s stand together for Amina Filali and the legacy of hope that her story must leave. 

With hope and determination,

Dalia, Antonia, Emma, Marie, Rewan, Alex, Ricken and the entire Avaaz team


PS - Many Avaaz campaigns are started by members of our community! Start yours now and win on any issue - local, national or global: http://www.avaaz.org/en/petition/start_a_petition/?bgMYedb&v=23917  

More information: 

Morocco set to repeal controversial rape section in penal code (Al Jazeera)
http://america.aljazeera.com/articles/2014/1/8/morocco-set-to-repealcontroversialrapelaw.html

Morocco MPs Ask to End Rapist Marriage Law After Teen Suicide (Bloomberg)
http://www.bloomberg.com/news/2014-01-09/morocco-mps-ask-to-end-rapist-marriage-law-after-teen-suici...

Morocco protest against rape-marriage law (BBC) 
http://www.bbc.co.uk/news/world-africa-17416426

Morocco mulls tougher line against rape-marriages (Al Jazeera)
http://www.aljazeera.com/news/africa/2012/03/20123171132404140.html 

Protesters in Morocco demand reform of rape laws after teen girl's suicide (CNN)
http://www.cnn.com/2012/03/17/world/africa/morocco-child-rape/index.html 

Global Rights report on violence against women in Morocco 
http://www.globalrig hts.org/site/DocServer/2011-10-14_Final_Shadow_Report_to_CAT.pdf?docID=12983 

Support the Avaaz Community!
We're entirely funded by donations and receive no money from governments or corporations. Our dedicated team ensures even the smallest contributions go a long way.

Donate Now



Thanks again for your help,

The Avaaz team

If you don't like Morrocon Law, I suggest you immigrate to a great country like Canada. 
 
My friend Mr. Mian Igbal, has stated that he shall give a discount to anyone who glorifies ALLAH asavajal, makes Salawat on RasoolALLAH SallAllwalahee wa salim and then mentions to him my Holy name, before placing an order with PILOT COURIER, so contact him at:

psx_20180105_232834.jpg

problems.jpg

CANADIAN SOIL

I learned from this article below, that It seems better to get married on Canadian Soil and fill out all the forms and appications from over here, if you want to live in Canada.

Fri Oct 8, 2010  4:30 PM By Frances Willick

A Leamington couple who flew to Mexico in June to deal with a personal tragedy have found themselves mired in a new nightmare: the bureaucracy of the Canadian immigration system.

The married couple, Gerhard Wiebe and Maria Eugenia Vazquez Cortes, travelled to Mexico June 1 to arrange family affairs after the death of Cortes’ mother in the central Mexican city of Tlaxcala. But when they tried to return to Canada on July 1, Cortes learned she would not be permitted back in.

“They won’t let her come back,” said Wiebe. “She is stuck down there.”

Cortes, 43, came to Canada about three years ago on a visitor’s visa and met Wiebe, 53, shortly after her arrival.

The couple married in 2008 and Cortes applied for permanent residency through Citizenship and Immigration Canada. While she waited to hear back about her application, her visitor’s visa was renewed every six months, permitting her to stay legally in Canada.

Before they flew to Mexico, Wiebe, 53, said they checked with the immigration ministry to ensure Cortes would be allowed back into Canada.

“They said there’s no problem because I have a sponsorship application,” Wiebe said. All they would have to do is apply for another visitor’s visa from the Canadian embassy in Mexico.

But when they did, it was denied.

Wiebe said the officer at the embassy wasn’t convinced that, if Cortes’ sponsorship application was rejected in Canada, she would return to her home country.

Now, that application can’t even be completed because Cortes isn’t on Canadian soil.

“It’s terrible that they’re separated,” said their lawyer, Thore Lederer. “You’re not talking about some Mexican person who’s going to come to Canada to file some fake refugee claim. This is a true family claim.”

Wiebe stayed in Mexico with his wife until the end of September to try to sort out the mess on that end.

Back home in Canada, Chatham-Kent-Essex MP Dave Van Kesteren lobbied on their behalf by writing a letter to the immigration ministry, Lederer said, but the ministry refused to intervene in the case.

Van Kesteren said in a statement Thursday that he and his office “have done and will continue to do everything we can to assist this family.

“I acknowledge that this must be a tough situation for this couple, however there are processes and rules in place, ones which we all must adhere to.”

Wiebe said he’s worried his wife will never be allowed back into Canada.

“It’s crazy,” said Wiebe. “I just don’t know what to do anymore. I’ve got to get her back.”

Unless the immigration ministry intervenes or the embassy officials grant Cortes a new visitor’s visa, Wiebe and his wife will have to start a new sponsorship application — a process that may take more than a year.

“It seems like they don’t understand that she doesn’t have nothing over there anymore,” Wiebe said. “We got everything here, but nothing there.”

Lederer called the ministry’s and embassy’s decisions “very harsh,” and expressed sympathy for the couple’s plight. “It’s a personal catastrophe to them,” the lawyer said. “They are a married couple. They love each other. They just want to live together.”

Citizenship and Immigration Canada could not provide comment on the case Thursday.

beinlove.jpg

Welcome to my Marriage Bureau!, which is in support of all women, especially those that listen to Qaseedas, like the Qaseeda of Habeeb Pak Ajami Rahmuth-Allah Alaih, and advise others to follow the Shariah of our deen, Islam! 
 
I, Syed Safe-udeen Ali, hope to utilize my life like Shaykh Hazim does, and thereby  spread the teachings of our Deen-Islam, contribute to world peace and make people ponder thoroughly over  The Wonders of Creation” InshALLAHutalah, such as I’ve listed below:
 
"The earth We spread out and set thereon mountains standing firm"
(Al-Qur'an 15:19)
"Is not He, Who has made the earth as a fixed abode, and has placed rivers in its midst, and has placed firm mountains therein, and has set a barrier between the two seas (of salt and sweet water)."
(Al-Qur'an 27:61)     
"The heaven, We have built it with power, Verily We are expanding it."
(Al-Qur'an 51:47)
"(God is) the one Who created the night, the day, the sun and the moon. Each one is traveling in an orbit with its own motion."
(Al-Qur'an 21:33)     
"Do not the Unbelievers see that the heavens and the earth were joined together (as one unit of creation), before We clove them asunder? We made from water every living thing. Will they not then believe?"
(Al-Qur'an 21:30)

“Then which of the favors of your Lord will you deny?"

 
 
I was really impressed with Shaykh Hazim's Hijaabi Neqaabi daughters.
 
 May ALLAH give all Muslim women the TOWFEEK (Guidance) to observe Purdah like them, Ameen!
Aik Rasta hay Zindagee
meinmyyouth.jpg
Jo Jumgaya to Kushbee Nahee
Click to hear Salaam Barzanjee
pinkshadehasbirabbi.jpg

jafirsadiqalaihsalam.jpg

ALLAH IS THE BEST WAKEEL
nemal.jpg
OBEY RasoolALLAH SallAllahwalaheewasalim https://www.gmx.com/
Taveez is NOT Shirk, it is Halaal to wear it.
awesometaweez.jpg
me.jpg

BEFORE GETTING MARRIED, IT'S GOOD TO GET TO KNOW THE DIFFERENCE BETWEEN WAHABEE AND SUNEE!!! CLICK ON THE LINK BELOW FOR MORE DETAILS, INSHALLAH!

http://www.differencebetween.net/language/difference-between-sunni-and-wahabi/comment-page-3/

AL-KABA'IR - The Chief Sins                            by Muhammad bin Uthman ad-Dhahabi

Hardback - 511 pages                                                                            English / Arabic  


Al-Kaba'r - The Major Sins

3rd Edition - 2006 C.E / 1427 AH

Imam ad-Dhahabi 'alayhir rahman wrote al-Kaba'ir (The Major Sins) specifically for a class of readers and is at the forefront of his works. The book is aimed at the general masses with simple language, but appeals to scholars and students alike.


Major Sins: (Page 3) --- The Major Sins are those acts that Allah Subhanahu wa Ta'ala and His Messenger Salla Allahu ta'ala 'alayhi wa Sallam have forbidden in the Qur'an and Sunnah (tradition of the Prophet), and which have been made clear by the actions of of the first righteous generation of Muslims, the Companions of the Prophet
Salla Allahu ta'ala 'alayhi wa Sallam.

<< If you avoid the great sins you are forbidden to Commit, We will cancel out your (other) evil deeds for you, and admit you (to Paradise) through a Noble entrance >> [an-Nisa'i 4:31]

Thus Allah Most High has guaranteed the Garden of Paradise to those who avoid the great sins. 


A Story: (Page 19) --- It is reported that a woman of the Children of Israel came to Prophet Moses Peace be upon him and said: “O Messenger of Allah, I committed a grave sin but then I repented to ALLAH and asked for his forgiveness. Please pray to ALLAH that he accepts my repentance and forgive my sin. “Prophet Moses Peace be upon him asked: “What did you do?” She replied: “Prophet of ALLAH, I committed fornication and later gave birth to a baby boy whom I Killed.” Then the Prophet Moses Peace be upon him said: “Go from here, you wicked woman, lest a fire from the Heaven consume all of us because of your monstrous sin!”

There-upon she left his presence broken-hearted.

Then the Arch-Angel Gabriel 
Peace be upon him descended and told Moses: “Moses, why have you turned away a repentant woman? Have you not found anyone worse than her? Moses asked: “Gabriel Peace be upon him
who could such a one be? “Gabriel said: “The one who abandons his prayer intentionally and persistently.”

"Al-KABAIR (The Major Sins)"
 
This is one of the most thought proving books I've ever read, even if you have  foul mouthed, bad mannered parents and relatives, I recommend you read this book thouroughly and try your best to avoid these sins, and pray that I do as well, inShALLAHutalah.

Based on ad-Dhahabi's famous work and The Path to Paradise by M.Tahlawi, Trans. By J. Zarabozo [IANA books (4)]

1. Associating partners with Allah (Shirk)

  • Great Shirk: worshipping beings other than Allah (proof all over Quran)
  • Small Shirk: Riya
The Prophet (saw), "Should I not inform you of that which I fear for you even more than the dangers of Dajjal? It is the hidden shirk: A person stands to pray and he beautifies his prayer because he sees the people looking at him". (Sahih; Sunan ibn Majah)

2. Committing murder: (Furqan; 68)

3. Performing Sorcery (2: 102)

4. Not performing the Prayers (Maryam: 59)

5. Withholding the Zakat (Charity) (3: 180)

6. Breaking the fast of Ramadhan or not fasting in that month with a valid excuse.

Prophet (saw) said, "Islam is built upon five pillars: testifying that there is no true god except Allah and that Muhammad is the messenger of Allah, performing the prayers, paying the zakat, making the pilgrimage to the house, and fasting the month of Ramadhan" (Sahih al-Jami # 2837)

7. Not performing the pilgrimage when one has the ability to do so (above hadith)

8. Disobeying one's parents (al-Isra: 23)

9. Cutting off the ties of relationships (Muhammad: 22)

10. Committing adultery or fornication (al-Isra: 30)

11. Committing sodomy

The Prophet (saw) said, "Allah will not look at a person (with pleasure) who commits sodomy with a man or a woman" (Sahih al-Jami # 7678)

12. Taking or paying interest (2: 275)

13. Devouring the wealth of orphans (4:10)

14. Forging statements concerning Allah or forging Hadith (al-Zumar: 60)

15. Fleeing from the battle (al-Anfal: 16)

16. Wrongdoing, deception or oppression on the part of the ruler (al-Shura: 42)

17. Being arrogant, boastful, vain (al-Nahl: 23)

18. Giving false testimony (al-Furqan: 72)

19. Drinking alcoholic beverages (5: 90)

20. Gambling (5: 90)

21. Slandering innocent women (al-Nur: 23)

22. Misappropriating something from the booty (3:161)

23. Stealing (5:38)

24. Committing highway robbery (5: 33)

25. Making false oath

Prophet (saw) said, "If someone is ordered to take an oath and he takes a false oath in order to take possession of property of a Muslim, then he will incur Allah's wreath when he meets Him" (Sahih al-Jami # 6083)

26. Committing oppression (al-Shuara: 277)

27. Levying illegal taxes

Prophet (saw) said, " Do you know who the bankrupt is? The bankrupt form my nation is the one who appears on the Day of Resurrection having performed the prayers, fasted and paid the zakat, but had also abused that person, slandered that person, wrongfully taken the wealth of that person and spilled the blood of that person. These people will take from his good deeds. If his good deeds are thereby exhausted, he will be given their sins and then he will be thrown into the hell-fire" (Sahih al-Jami #87)

28. Consuming forbidden wealth or taking it by any means (2: 188)

29. Committing suicide (4: 29)

30. Being a perpetual liar (3: 61)

31. Ruling by laws other than the laws of Islam (5: 44)

32. Engaging in bribery (2: 188)

33. Women appearing like men and vice-versa

Prophet (saw) said, "Allah's curse is upon women who appear like men and upon men who appear like women" (Sahih al-Jami # 4976)

34. Being a dayyouth

Dayyouth: is the one who approves the indecency of his womenfolk and who is void of jealousy or the pimp who facilitates indecency between two people

Prophet (saw) said, "Allah has forbidden the Paradise to three people: the alcoholic, the runaway slave, and the one who is complacent in the face of the evil deeds that his family is performing" (Sahih al-Jami # 3047)

35. Marrying for the purpose of making a woman allowable for another (Baqarah)

36. Not keeping clean from the remains of urine

Ibn Abbas reported that Prophet (saw) passed by a grave and said, "These two are being punished and they are not being punished for something hard. But it is a great sin. One of them did not keep himself clean form his urine and the other went around spreading tales" (Sahih al-Jami # 2436)

37. Acting for show (al-Maoon: 4-6)

38. Acquiring knowledge only for worldly gain or concealing knowledge (2: 160)

39. Breaching trusts (al-Anfal: 27)

40. Reminding people of one's kindness (2: 27)

41. Denying predestination (al-Qamar: 49)

"If Allah were to punish the inhabitants of the heavens and earths, then He would punish and He would not be doing injustice to them. If He were to have mercy on them, His mercy would be greater than from their actions. If a person had amount of gold equivalent to Mount Uhud or similar to Mount Uhud and spent it in the Path of Allah, (that spending) would not be accepted form him by Allah until he believes in the preordainment of good and evil. And until he knows that what afflicted him was not going to miss him and what missed him was not going to afflict him. If you were to die with any belief other than that, you would enter the Hellfire" (Kitab al-Sunnah by Ibn Abu Asi # 245. Albani says that its chain is sahih)

42. Eavesdropping on other's private conversation (Hujarat: 12)

43. Spreading harmful tales(al-Qamar: 10)

44. Cursing others

Prophet (saw) said, "Abusing a Muslim is evil and fighting him is disbelief" (Sahih al-Jami # 3598)

45. Not fulfilling one's promises

Prophet (saw) said, "Whoever has a four characteristic is a complete hypocrite. Whoever posses any of these characteristics has the characteristics of hypocrisy until he gives it up; whenever he makes a promise, he breaks it up…" (Bukhari)

46. Believing in what soothsayers & astrologers say

Prophet (saw) said, "Whoever goes to fortuneteller and asks him about something will not have his prayer accepted for forty nights" (Sahih al-Jami # 5816)

47. A wife being rebellious to her husband (4: 34)

48. Putting pictures of beings with souls on clothing, curtains, rocks and any other items

Prophet (saw) said, "…the people who will receive the greatest punishment on the day of judgment are those who compete with Allah in creation [those who make pictures or statues]" (sahih al-Jami # 1691)

49. Striking one's self, wailing, tearing one's clothing, pulling one's hair & similar deeds as a form of mourning

Prophet (saw) said, "One who strikes his cheeks or tears his clothing and shouts in the manner of pre-Islamic culture is not one of us" (Sahih al-Jami # 5713)

50. Committing injustice (al-Shura: 42)

51. Being overbearing or taking advantage of the weak, slaves, wives or animals

Prophet (saw) said, "Allah will torture those who torture people in this world" (Muslim)

52. Harming neighbors

Prophet (saw) said, "A person whose neighbor is not safe from his mischief will not enter paradise" (sahih al-Jami # 7002)

53. Harming and abusing Muslims (al-Ahzab: 58)

54. Wearing one's clothes too long, i.e. below the ankles

Prophet (saw) said, "What is below the ankles will be in the hellfire [note: this is a general hadith which applies irrespective of whether pride is involved or not and is not limited to prayers]" (Bukhari)

55. Harming the slaves of Allah

Prophet (saw) said that Allah said, "Whoever shows enmity to a slave of Mine (Allah's) I shall be at war with him" (Sahih al-Jami # 1778)

56. Men wearing silk & gold

Prophet (saw) said, "Gold and silk have been permitted for the females of my nation and forbidden for its males" (Sahih al-Jami # 209)

Prophet (saw) said, "Men who wears silk in this world will have no portion [of heavens] in the hereafter" (Muslim)

57. Running away of a slave

Prophet (saw) said, "If a slave runs away, his prayers will not be accepted" (Sahih al-Jami # 257)

58. Sacrificing animals for other than Allah

Prophet (Saw) said, "The one who sacrifices for other than Allah is cursed by Allah" (Sahih al-Jami # 4988)

59. Claiming that somebody is one's father while the claimant knows it is not true

Prophet (saw) said, "One who claims that someone is his father and knows that it is not true will be forbidden of paradise" (Sahih al-Jami # 5865)

60. Arguing or quarreling for show & not seeking the truth

Prophet (saw) said, "Whoever argues in support of something that is wrong and he knows it Allah will be angry with him until he stops" (Sahih al-Jami # 6073)

61. Not allowing excess water to flow to others

Prophet (saw) said, "Whoever doesn't allow the access water or pasture for others will not share in the blessings of Allah on the day of judgment" (Sahih al-Jami # 6436)

62. Not measuring the weights properly (al-Mutafafifeen: 1-3)

63. Thinking that one is safe from Allah's planning (al-Araf: 99)

64. Eating carrion, blood or pork meat (al-Anam: 145)

65. Not praying in the congregation & praying by one's self without a valid excuse

Prophet (saw) said, "Whoever hears the call to prayer and doesn't come to prayer, there is no prayer for him say for the one who has valid excuse" (Sahih al-Jami # 6176)

66. Continually not performing the Friday prayers and congregational prayers without any valid excuse

Prophet (saw) said, "If people don't stop abandoning the Friday Prayers Allah may seal their hearts and they will become headless" (Muslim)

67. Harming others by manipulation one's bequests (4: 12)

68. Being deceitful or deceptive (Fatir: 43)

69. Spying on the Muslims & pointing out their secrets (al-Kalam: 11)

70. Abusing or reviling anyone of the Companions of the Prophet (saw)

Prophet (saw) said, "Do not revile my companions for, by the one in whose hands is my soul, if you were to spend in charity a mountain of gold similar to mount Uhud it would not be equal to a handful or a half a handful (or what they have done)" (Sahih al-Jami # 7187)

Please make sincere repentance to Allah before as Ali (ra) said, "Today is deed without reckoning and tomorrow is reckoning without deeds". Sincere repentance has four conditions :

    • Feeling bad for the sin
    • Firm commitment in intention not to repeat sin (whether it happens again is not a condition if one tried his best)
    • Make repentance to Allah by Du'a and asking or better crying for forgiveness
    • If some person has been wronged because of this sin then one needs to make up to this person
 



The sites back up alhamdulillah!


Major Sins (Al Kaba'ir)





The major sins are those acts which have been forbidden by Allah in the Quran and by His Messenger (Sal Allaahu alayhi waSalam) in the Sunnah (practise of the Prophet), and which have been made clear by the actions of of the first righteous generation of Muslims, the Companions of the Prophet (SAW)


There is some difference of opinion among scholars in this regard. Some say these major sins are seven, and in support of their position they quote the tradition: 'Avoid the seven noxious things'- and after having said this, the propeht (SAW) mentioned them: 'associating anything with Allah; magic; killing one whom Allah has declared inviolate without a just case, consuming the property of an orphan, devouring usury, turning back when the army advances, and slandering chaste women who are believers but indiscreet.' (Bukhari and Muslim)
'Abdullah ibn 'Abbas said: 'Seventy is closer to their number than seven,' and in this book Imam Dhabi goes through the 70 Major Sins Supported by the Qur'an and the Sunnah of the Prophet Muhammad (SAW)


The Author Muhammad bin Ahmad bin `Uthman bin Qaymaz at Turkamani, Shams al-Din al-Dimashqi al-Dhahabi al-Shafi`i (673-748 AH), the imam, Shaykh al-Islam, head of hadith masters, critic and expert examiner of the hadith, encyclopedic historian and biographer, and foremost authority in the canonical readings of the Qur'an. Born in Damascus where his family lived from the time of his grandfather `Uthman, he sometimes identified himself as Ibn al-Dhahabi - son of the goldsmith - in reference to his father's profession.


- Download Book -
- Purchase Book -

 

Sins & Punishments

Sins & It's effects

Erasing Sins

Major Sins & Sins of Limbs

Punishments

 

Aslam-u-Alaykum Wa Rahmatullah-e-Wa Barakathu Wa Maghfirathu,

Below I've listed the sayings of one of Sham's Greatest Sufees, The Prince of Balcoh: Hadruth Ibraheem ibnay Adham KarmAllahu Wajhu Alaih Salaat wa Salaam

Ten Sicknesses of The Heart
1.You believe in the existance of Allah Ta'ala, but you do not fulfil his commands.
2.You say you love the Holy Prophet Mohammed (Sallallahu 'alahi wasallam), but you do not follow his sunnah (ie, his example).
3.You Read The Qur'an but you do not put it into practice.
4.You enjoy all the benefits from Allah Ta'ala, but you are not grateful to him.
5.You acknowledge Shaytan as your enemy, but you do not go against him.
6.You want to enter paradise, but you do not work for it.
7.You do not want to be thrown into hell-fire, but you do not try to get away (ie, do good deeds).
8.You believe that every living-thing will face death, but you do not prepare for it.
9.You gossip and find faults in others, but you forgot your own faults and mistakes.
10.You bury the dead, but you do not take a lesson from it.
~~~~~~~~~~~~~~~~~~~~~~~~~~~
May Allah Ta'ala help us to get rid of the cravings of our egos and help us to implement his law (Shariah), and the sunnah of his beloved Prophet Sayyidinna Muhammed (sallallahu 'alahi wasallam) in our everyday lives.
Ameen

I stongly advise you NOT to Register at https://www.shaadi.com/registration/user/login , because after you register & make up a private password, they may hack the password, change it, then use your profile to stalk women, Na-Azou-Billah!!! My Profile on it is HACKED. In the past I had gone to a Hindi Music concert where my wallet disappeared like magic, I'ts a possibility the criminal used my former stolen SIN Card to fool Shaadi.com to give him my password to conduct the fraud profile tricks. The Messenger of Allah ﷺ, said, “No people sit in a gathering in which they did not remember Allah, nor send blessings upon the Prophet, but that it will cause them grief on the Day of Resurrection, even if they are rewarded with entry into Paradise.”[Musnad Ahmad] My old phone number 647-939-7867 has been given to someone else, I hope that Desi is not a PIMP, or he might be. So don't expect to talk to me via that number. After using the Gov't Computers at the YMCA & the Library, I noticed on my personal Windows HP that somehow a smart phone (Nexus) & an Apple Ipad had access to my Google account. On an unsecured network, hackers may be able to spy on the information you send, such as when you enter a password or credit card information on a website. They may even be able to monitor the keystrokes you make on your keyboard, allowing them to record your logins or private conversations. (Some Pervert hacked into my Twitter Account, & added a Oriental Woman as Friend he liked, PRETENDING TO BE ME, I don't even know her!!!) Cybercriminals can also circulate malware or launch worm attacks over unsecured WiFi. Even public WiFi networks that require a password aren't safe if that same password is readily available to anyone in the establishment, such as a coffee shop or doctor's office. I've know realized that when you open your e-mail on Gov't computers, your email account is transferred & ethically hacked onto devices belonging to strangers. Therefore it's best to log out from both theirs & your personal computer & then make a new password, to prevent evil people from doing ID-FRAUD tricks, in Sha Allah. UPON FILING MY EQUIFAX REPORT I WAS AMAZED TO FIND OUT THAT SOMEONE PRETENDING TO BE ME, HAD PURCHASED A HOUSE IN MY NAME, I HAVE NO IDEA OF THE ADDRESS OF THAT HOUSE. I WONDER IF NASIR ROSTUM (905 897-7781) PUT THE MONEY TOWARD THE DOWN-PAYMENT TOWARDS HIS HOUSE @ 904 Focal Rd, FOOLING THE BANK TO ASSUME I'M THE OWNER OF THAT PROPERTY. ACCORDING TO A TRANSUNION CONSUMER DISCLOSURE, SOMEONE ACTING TO BE ME HAD WITHDRAWN $24,000, AFTER OPENING A LINE OF CREDIT ACCOUNT WITH THE CIBC BANK. I USED TO RENT NASIR ROSTUM'S BASEMENT. NASIR DECIDED TO HAVE A PARTY FOR WOMAN IN THE BASEMENT ONE DAY. I NOTICED MY CELL-PHONE WAS MISSING. UPON MAKEING AN INQUIRY WITH HIM HE SAID: HE DOESN'T KNOW WHERE IT IS. DUE TO MY BUSY SECURITY GUARD WORK SCHEDULE I PURCHASED A NEW PHONE, WITH A NEW NUMBER. IF ANYONE OF YOU RECEIVES A CALL FROM MY OLD NUMBER 416 825-1749. PLEASE SEND ME AN E-MAIL TO INFORM ME WHO IS THE NEW OWNER OF MY OLD NUMBER. I'VE NOTICED THAT BOTH CIBC & TD BANK MANAGEMENT ARE FILLED WITH HINDUS@SENIOR MANAGEMENT POSITIONS. I HOPE THE HINDUS(Ashok Kumar Gera) ARN'T USING THE MONEY TO FUND THE ILLEGAL TRAFFIC GIRL PIMPING BUSINESS. ACCORDING TO PEEL REGIONAL POLICE, A TRAFFIC GIRL MADE $280,000 ANNUALLY. Once I was at the Novotel Hotel, where I met a Pakistani Muslim girl by the name of Aleena Khan. Miss Khan told me her Hindu boyfriend got her drunk, then brought her to the hotel. I told her to dial 911, pretending to be really sick & ask for the Ambulance. (The Hotel has now changed into a Marriot without any payphone like before). I would have called the cops myself, but didn't because I didn't want the Novotel Hotel employees to have a dangerous grudge against me. The evil tactics of Hindus to enjoy young muslim girls could be the MAIN REASON behind the Taj Mahal Hotel Massacre. A man who starts knowing his mistakes & keeps busy in correcting them is the most noble man. Hadruth Bayazid Bastami RahmuthAllah Alay Salaam!

"Some Evil Hindus that get muslim girls drunk, than traffic them in to hotels, deserve to be Massacred."

 

        Almighty Allah says:
    And marry those among you who are single and those who are fit among your male slaves and your female slaves; if they are needy, Allah will make them free from want out of His grace; and Allah is Ample-giving, Knowing. (Holy Qur'an 24:32)
    And do not marry the idolatresses until they believe, and certainly a believing maid is better than an idolatress woman, even though she should please you; and do not give (believing women) in marriage to idolaters until they believe, and certainly a believing servant is better than an idolater, even though he should please you; these invite to the fire, and Allah invites to the garden and to forgiveness by His will, and makes clear His communications to men, that they may be mindful. (Holy Qur'an 2:221)
    O you men! surely We have created you of a male and a female, and made you tribes and families that you may know each other; surely the most honorable of you with Allah is the one among you most careful (of his duty); surely Allah is Knowing, Aware. (Holy Qur'an 49:13)
    The Messenger of Allah (S.A.W.) said:
    MuhummedIf someone of good character and conduct proposes to your daughters, marry them. If you do not, there will be mischief and great corruption on Earth. (Kulayni and Tirmidhi)
    Whoever marries a woman for her glory, Allah will not increase his, but will bring him humiliation; whoever marries her for her wealth, Allah will not increase his, but place him in poverty; whoever marries her for ancestral claims, Allah will not increase his, but in meanness; whoever marries a woman for nothing but to cast down his eyes, guard his private parts, and to establish a relationship, Allah will bless him through her and vice versa. (Al-Targhib wa al-Tarhib)
    Women were married for four reasons: for their wealth, their status, their beauty and their religion, and that the good Muslims were the ones who married women because of their faith. (Muslim)
    Whoever gets married, has safeguarded half of his religion. - The Prophet of Islam (saw)
    There is no better structure founded in Islam other than marriage. - The Prophet of Islam (saw)
    Whoever chooses to follow my tradition must get married and produce offspring through marriage (and increase the population of Muslims) so that on the day of resurrection I shall confront other Ummah (nations) with the (great) numbers of my Ummah. - The Prophet of Islam (saw)
    The most detestable of the lawful things in Allah eyes is divorce. - The Prophet of Islam (saw)
    The greatest blessing in the world is a pious wife. - The Prophet of Islam (saw)
    Verily, the most perfect amongst believers in faith is he who is the best in manner and the kindest to his wife. - The Prophet of Islam (saw)
    Any woman who dies when her husband is pleased with her will enter Paradise. - The Prophet of Islam (saw)
    Allah will become angered with a married woman if she fills her eyes with the look of strangers. - The Prophet of Islam (saw)
    A woman may only fast with her husband's permission. - The Prophet of Islam (saw)
    The words of a husband to his wife, "I truly love you," should never leave her heart. - The Prophet of Islam (saw)
    If a man helps his spouse in household work, Allah records for him spiritual reward equal to the hair on his body as if he had fasted during days and offered prayers during nights for one full year. - The Prophet of Islam (saw)
    A man said to the Messenger of Allah (saw): I have a wife who welcomes me at the door when I enter the house, and sees me off when I leave. When she sees me grieved, asks me: 'What are you grieved for? If you are anxious about your livelihood, it is guaranteed by other than you: or if you are worried about the hereafter, may Allah increase your worries.' The Messenger of Allah said: "Allah has agents and she is one of them. She will get half a martyr's reward."
    The Messenger of Allah was asked, "What rights do our wives have over us?" He replied: "You shall feed her as you feed yourself, clothe her as you clothe yourself; you shall not slap her on the face, nor revile [her], nor leave her [alone] except within the house."
    If a woman does not perform her duty as a spouse, she has not done her duty to Allah. - The Prophet of Islam (saw)
    A bad woman does not forgive her husband's mistake and does not accept his apology. - The Prophet of Islam (saw)
    Engage in marriage; because this is the tradition of the Prophet (saw) of Allah. - Imam Ali (as)
    Women are like flowers. They should be treated gently, kindly, and with affection. - Imam Ali (as)
    Act moderately with women in every instance. Speak to them nicely in order that their deeds become good. - Imam Ali (as)
    Whoever is our friend, expresses kindness to his spouse more often. - Imam Ja'far al-Sadiq (as)
    May Allah bless a man who creates a good relationship with his wife, because Allah has appointed man to be the guardian of his wife. - Imam Ja'far al-Sadiq (as)
    When you love someone, let the person know. - Imam Ja'far al-Sadiq (as)
    Whoever marries must respect his wife. - Imam Ja'far al-Sadiq (as)
    The best women among your women are those who show appreciation when their husbands bring home something and are not discontented if nothing is brought home. - Imam Ja'far al-Sadiq (as)
    Who is lucky man? "Imam Rida (as) stated: The greatest gain for a man is a faithful woman who, when she sees him, becomes happy and protects his property and her own honor in his absence.
    Some women are blessings for their husbands who express their love and affection. - Imam Ridha (as)

    Get the one who is religious and prosper. (Bukhari)  

marrysomeonethatwillhelpyougetclosertoallah.jpg

husbandandwife.jpg

Me and my Sister's Son Soloman were resting in peace

meandsolimaanwerejustresting.jpg

This is me, with my Nephew, King Solimaan!, we were resting, when his mother, my sister took this picture!

myattemptatmodellingforhmiin94.jpg

Buyan on the creation of Hudruth Adam Alaih Salaam
thisismyyoungerversionin1993-94.jpg
https://www.youtube.com/watch?v=666BAmYUMrU

themasjidinthebackgroundismasjidkuttakeenabalow.jpg

greatduastomake.jpg

rabbizidneeilmun.jpg
O Prophet! Tell your wives & your daughters and the women of the believers to draw their cloaks ("Jalabib") veils all over their bodies (screen themselves completely except the eyes or one eye to see the way Tafseer Al-Qurtabi) that is most convenient that they should be known (as such) and not molested: and Allah is Oft-Forgiving Most Merciful."
Surah An-Nur, Verses #30 and #31 And Say to the believing women to lower their gaze (from looking at forbidden things), and protect their private parts (from illegal sexual acts) and not to show off their adornment except only that which is apparent (like both eyes for necessity to see the way, or outer palms of hands or one eye or dress like veil, gloves, head cover, apron), and to draw their veils all over Juyubihinna (i.e. their bodies, faces, necks and bosoms)
From the Hadith.....
Sahih Al-Bukhari Volume 6, Book 60, Hadith # 282
Narrated Safiya bint Shaiba (Radhiallaahu Ánha) "Aisha (Radhiallaahu Ánha) used to say: "When (the Verse): "They should draw their veils over their necks and bosoms," was revealed, (the ladies) cut their waist sheets at the edges and covered their faces with the cut pieces.
Sahih Al-Bukhari Volume 1, Book 8, Hadith # 368
Narrated 'Aisha (Radhiallaahu Ánha) Rasulullah (Sallallaahu Álayhi Wasallam) used to offer the Fajr prayer & some believing women covered with their veiling sheets used to attend the Fajr prayer with him and then they would return to their homes unrecognized . Shaikh Ibn Uthaimin in tafseer of this hadith explains "This hadith makes it clear that the Islamic dress is concealing of the entire body as explained in this hadith. Only with the complete cover including the face and hands can a woman not be recognized. This was the understanding and practice of the Sahaba & they were the best of group, the noblest in the sight of Allah (swt) with the most complete Imaan and noblest of characters. so if the practice of the women of the sahaba was to wear the complete veil then how can we deviate from their path? (Ibn Uthaimin in the book "Hijaab" page # 12 and 13)
Sahih Al-Bukhari Volume 1, Book 4, Hadith # 148
Narrated 'Aisha (Radhiallaahu Ánha): The wives of Rasulullah (Sallallaahu Álayhi Wasallam) used to go to Al-Manasi, a vast open place (near Baqia at Medina) to answer the call of nature at night. 'Umar used to say to the Prophet "Let your wives be veiled," but Rasulullah (Sallallaahu Álayhi Wasallam) did not do so. One night Sauda bint Zam'a the wife of the Prophet went out at 'Isha' time and she was a tall lady. 'Umar addressed her and said, "I have recognized you, O Sauda." He said so, as he desired eagerly that the verses of Al-Hijab (the observing of veils by the Muslim women) may be revealed. So Allah revealed the verses of "Al-Hijab" (A complete body cover excluding the eyes).
Tirmidhi with a SAHIH chain reports...
"Rasulullah (Sallallaahu Álayhi Wasallam) said: All of a woman is Awrah" (Shaikh Muhammed Salih Al-Munajjid quotes this hadith narrated by Tirmidhi with a sahih isnaad & says this is a direct hadith from RasulAllah (SallAllaahu Álayhi Wasallam ) & has made it clear that a woman must cover everything including the face and hands!)
Abu Dawood Book 14, Hadith # 2482
Narrated Thabit ibn Qays (Radhiallaahu Ánhu): A woman called Umm Khallad came to the Prophet (Sallallaahu Álayhi Wasallam) while she was veiled. She was searching for her son who had been killed (in the battle) Some of the Companions of the Prophet (Sallallaahu Álayhi Wasallam) said to her: You have come here asking for your son while veiling your face? She said: If I am afflicted with the loss of my son, I shall not suffer the loss of my modesty. Rasulullah (Sallallaahu Álayhi Wasallam) said: You will get the reward of two martyrs for your son. She asked: Why is that so, oh Prophet of Allah? He replied: Because the people of the Book have killed him.
Abu Dawood Book 32, Hadith # 4090
Narrated Umm Salamah, Ummul Mu'minin (Radhiallaahu Ánha): When the verse "That they should cast their outer garments over their persons" was revealed, the women of Ansar came out as if they had crows over their heads by wearing outer garments.
Abu Dawood Book 32, Hadith # 4091
Narrated Aisha, Ummul Mu'minin (Radhiallaahu Ánha) "May Allah have mercy on the early immigrant women. When the verse "That they should draw their veils over their bosoms" was revealed, they tore their thick outer garments and made veils from them. Ibn Hajar Al-Asqalanee, who is known as Ameer Al-Mu'mineen in the field of Hadith, said that the phrase, "covered themselves", in the above Hadith means that they "covered their faces". [Fath Al-Bari].
Imaam Malik's MUWATTA Book 20 Hadith # 20.5.16
Yahya related to me from Malik from Hisham ibn Urwa that Fatima bint al-Mundhir (Radhiallaahu Ánha) said, "We used to veil our faces when we were in Ihram in the company of Asma bint Abi Bakr As-Siddiq (Radhiallaahu Ánha). "This again proves that not only the wives of Rasulullah (Sallallaahu Álayhi Wasallam) wore the Niqaab and that even though in Ihram women are not supposed to wear Niqaab but if men are there they still have to cover the face.
Abu Dawood Book 10, Hadith # 1829
Narrated Aisha, Ummul Mu'minin: (Radhiallaahu Ánha) who said, "The riders would pass us while we were with the Messenger of Allah (Sallallaahu Álayhi Wasallam). When they got close to us, we would draw our outer cloak from our heads over our faces. When they passed by, we would uncover our faces.
Recorded by Ahmad, Abu Dawood and Ibn Majah, Narrated 'Aisha. [In his work Jilbab al-Marah al-Muslimah, al-Albani states (p. 108) that it is hasan due to corroborating evidence. Also, in a narration from Asma {who was not the wife of RasulAllah (Sallallaahu Álayhi Wasallam)}, Asma also covered her face at all times in front of men.] Shaikh Ibn Uthaimin in his tafseer of this hadith explains "This hadith indicates the compulsion of the concealing of the faces as an order of Shariah, because during the Ihram it is "wajib" (compulsory) NOT to wear the Niqaab. So if it was only mustahab (recommended) to cover the face then Aisha & Asma (RadhiAllaahu Ánha) would have taken the wajib over the mustahab. It is well known by the Ullima that a wajib can only be left because of something that is also wajib or fardh. So Aisha and Asma (Radhiallaahu Ánha) covering the face even in Ihram in the presence of strange (ghairMahraam) men shows that they understood this to be an act that was wajib or fardh or they would not have covered the face in Ihraam. Sahih Al-Bukhari Volume 7, Book 72, Hadith # 715
Narrated 'Ikrima (Radhiallaahu Ánhu) narrates "Rifa'a divorced his wife whereupon 'AbdurRahman bin Az-Zubair Al-Qurazi married her. 'Aisha said that the lady (came), wearing a green veil." It is a very long hadith but the point is the women of Sahaba wore the full veil.
Sahih Al-Bukhari Volume 1, Book 8, Hadith # 347
Narrated Um 'Atiya (Radhiallaahu Ánha) We were ordered (by Rasulullah '(Sallallaahu Álayhi Wasallam) to bring out our menstruating women and veiled women in the religious gatherings and invocation of Muslims on the two 'Eid festivals. These menstruating women were to keep away from their Musalla. A woman asked, "O Allah's Apostle ' What about one who does not have a veil (the veil is the complete cover with only one eye or two eyes showing)?" He said, "Let her share the veil of her companion." Shaikh Ibn Uthaimin in tafseer of this hadith explained "This hadith proves that the general norm amongst the women of the Sahaba (Radhiallaahu Ánhuma) was that no woman would go out of her home without a cloak, fully concealed and if she did not posses a veil, then it was not possible for her to go out. it was for this reason that when Rasulullah (Sallallaahu Álayhi Wasallam) ordered them to go to the Place for Eid Salah, they mentioned this hindrance. As a result RasulAllah (Sallallaahu Álayhi Wasallam) said that someone should lend her a veil, but did not say they could go out without it. If RasulAllah (Sallallaahu Álayhi Wasallam) did not allow women to go to a place like the Eid Salah, which has been ordered by Shariah for women and men alike, then how can people let women to out to market places and shopping centers without where there is open intermingling of the sexes, without a veil. (by Shaikh Ibn Uthaimin in the book "Hijaab" page # 11) Sahih Al-Bukhari Volume 8, Book 76, Hadith # 572
In the end of this very long hadith it quotes Anas (Radhiallaahu Ánho) rates from Rasulullah (Sallallaahu Álayhi Wasallam) "and if one of the women of Paradise looked at the earth, she would fill the whole space between them (the earth and the heaven) with light, and would fill whatever is in between them, with perfume, and the veil of her face is better than the whole world and whatever is in it." This shows that even the women of Junnah have veils and the word veil is what covers the face (Niqaab).
Abu Dawood Book 33, Hadith # 4154, Agreed upon by Nasai
Aisha(Radhiallaahu Ánha) narrates that on one occasion a female Muslim wanted to give a letter to the Holy Prophet (Sallallaahu Álayhi Wasallam), the letter was delivered to the Holy Prophet (Sallallaahu Álayhi Wasallam) from behind a curtain.
Note: Quoted in the famous book Mishkaat. Here the Mufasereen of hadith have explained that the hadith where women came up to Rasulullah (Sallallaahu Álayhi Wasallam) face to face were before the ayah "And when you ask (his wives) for anything you want, ask them from behind a screen, that is purer for your hearts and for their hearts." (Surah Ahzâb ayah # 53) And this hadith proves this order is for the whole Ummah not just for the wives of Rasulullah (Sallallaahu Álayhi Wasallam)!
Abu Dawood Book 2, Hadith # 0641
Narrated Aisha, Ummul Mu'minin (Radhiallaahu Ánha) "Rasulullah (Sallallaahu Álayhi Wasallam) said "Allah does not accept the prayer of a woman who has reached puberty unless she wears a veil."
Sahih Al-Bukhari Volume 9, Book 89, Hadith # 293
Narrated 'Aisha (Radhiallaahu Ánha) Utba bin Abi Waqqas said to his brother Sa'd bin Abi Waqqas, "The son of the slave girl of Zam'a is from me, so take him into your custody." So in the year of Conquest of Mecca, Sa'd took him and said. (This is) my brother's son whom my brother has asked me to take into my custody." 'Abd bin Zam'a got up before him and said, (He is) my brother and the son of the slave girl of my father, and was born on my father's bed." So they both submitted their case before Rasulullah (Sallallaahu Álayhi Wasallam). Sa'd said, "O Allah's Apostle! This boy is the son of my brother and he entrusted him to me." 'Abd bin Zam'a said, "This boy is my brother and the son of the slave girl of my father, and was born on the bed of my father." Rasulullah (Sallallaahu Álayhi Wasallam) said, "The boy is for you, O 'Abd bin Zam'a!" Then Rasulullah (Sallallaahu Álayhi Wasallam) further said, "The child is for the owner of the bed, and the stone is for the adulterer," RasulAllah (Sallallaahu Álayhi Wasallam) then said to Sauda bint Zam'a, "Veil (screen) yourself before him," when he saw the child's resemblance to 'Utba. The boy did not see her again till he met Allah. note: This hadith proves Rasulullah (Sallallaahu Álayhi Wasallam) did infact order the veil to be observed.
Sahih Al-Bukhari Volume 7, Book 65, Hadith # 375
Narrated Anas (Radhiallaahu Ánhu) I know (about) the Hijab (the order of veiling of women) more than anybody else. Ubai bin Ka'b used to ask me about it. Allah's Apostle became the bridegroom of Zainab bint Jahsh whom he married at Medina. After the sun had risen high in the sky, the Prophet invited the people to a meal. Rasulullah (Sallallaahu Álayhi Wasallam) remained sitting and some people remained sitting with him after the other guests had left. Then Rasulullah (Sallallaahu Álayhi Wasallam) got up and went away, and I too, followed him till he reached the door of 'Aisha's room. Then he thought that the people must have left the place by then, so he returned and I also returned with him. Behold, the people were still sitting at their places. So he went back again for the second time, and I went along with him too. When we reached the door of 'Aisha's room, he returned and I also returned with him to see that the people had left. Thereupon Rasulullah (SallAllaahu Álayhi Wasallam) hung a curtain between me and him and the Verse regarding the order for (veiling of women) Hijab was revealed.
Abu Dawood Book 32, hadith # 4100
Narrated Umm Salamah, Ummul Mu'minin (Radhiallaahu Ánha): I was with Rasulullah (Sallallaahu Álayhi Wasallam) while Maymunah was with him. Then Ibn Umm Maktum came. This happened when we were ordered to observe veil. Rasulullah (Sallallaahu Álayhi Wasallam) said: Observe veil from him. We asked: oh Rasulullah! is he not blind? He can neither see us nor recognize us. Rasulullah (Sallallaahu Álayhi Wasallam) said: Are both of you blind? Do you not see him?

The opinions of the great scholars about the Niqaab...
From the Sahaba (RadhiAllaahu Ánhuma) .......
Ibn Ábbaas (Radhiallaahu Ánhu), who was one of the most knowledgeable companions of Rasulullah (Sallallaahu Álayhi Wasallam), Rasulullah (Sallallaahu Álayhi Wasallam) even made duwaa for him saying "O Allah, make him acquire a deep understanding of the religion of Islam and instruct him in the meaning and interpretation of things."
Ibn Jarir (Rahimahullah) with an authentic chain of narrators has quoted Ibn Abbaas' (Radhiallaahu Án) opinion was "that the Muslim women are ordered to cover their head and faces with outer garments except for one eye." (This is quoted in the Ma'riful Qur'an in the tafseer of Surah Ahzaab ayah # 33, with reference of Ibn Jarir with a sahih chain of narrators). The Tabiee Ali Bin Abu Talha explained that this was the last opinion of Ibn Abbas and the other opinions quoted from him were from before Surah Al-Ahzaab, Verse #59 and the order of the "Jalabib". Shaikh Ibn Uthaimin commented on this saying of Ibn Abbaas (RadhiAllaahu Ánhu) by saying "This statement is "Marfoo" and in shariah that is the same category as a hadith which is narrated directly from Rasulullah (Sallallaahu Álayhi Wasallam). The quote of Ibn Abbas is quoted by many tabi'een like Ali Ibn Abu Talha and Ibn Jarir in Ma'riful Quran by Mufti Muhammad Shafi vol.7 pg.217 and also in Tafseer Ibn Jarir, Vol. 22, pg.29 and also by Imaam Qurtabi all with SAHIH Chains and explained in the book "Hijaab" by Ibn Uthaimin, Page # 9 and authenticated in the book "Hijaab wa Safur"by Shaikh-ul-Islam Ibn Taymiyyah (Rahimahullah) on page #11 and by Shaikh AbdulAziz bin Bazz (Rahimahullah) on page # 55 and 60 )
Abdullah Ibn Mas'ud (RadheeAallaahu Ánhu) Who was known as the most knowledgeable Sahabi in matters of Shariah. He became Muslim when he was a young kid and ever since that he stayed with Rasulullah (SallAllaahu Álayhi Wasallam)& gained the understanding of Quran from him. Umar Ibn Khattab (Radhiallaahu Ánhu) said about him "By Allah, I don't know of any person who is more qualified in the matters dealing with the Quran than Abdullah Ibn Mas'ud"
Explained, the word Jilbaab (as mentioned in the Quran Surah Ahzaab ayah # 59 ) means a cloak which covering the entire body including the head, face & hands. (Quoted from Ibn Taymiyyah (Rahimahullah) in his book on fatwaas Page# 110 Vol # 2 & By Shaikh Ibn Uthamin in the book Hijaab Page # 15)
Aisha (Radhiallaahu Ánha)
Stated that in verse 30 and 31 of Surah An Nur "What has been allowed to be shown is the hands, bangles & rings but the face must be covered.
(Quoted by Shaikh Abdul A'la Maududi in the book Purdah P# 195 and in his Tafseer of Quran under the tafseer of Surah An Nur)
Abu Ubaidah Salmani (Radhiallaahu Ánhu). Another well known Sahabi is quoted saying "Jilbaab should fully cover the woman's body, so that nothing appears but one eye with which she can see." (Tafseer Al-Qurtubi) And In the time of Rasulullah (Sallallaahu Álayhi Wasallam) "The women used to don their cloaks (Jilbaabs) over their heads in such a manner that only the eyes were revealed in order to see the road." (The Book "Hijaab" page # 9)
Ubaida bin Abu Sufyan bin al-Harith('Radhiallaahu Ánhu' An' Other well known and knowledgeable Companion of Rasulullah ) Imam Muhammad bin Sirin (Rahimahullah) One of the most knowledgeable tabi'een) said "When I asked Ubaida bin Sufyan bin al-Harith ('Radhiallaahu An') how the jalbaab was to be worn, he demonstrated it to me by pulling a sheet of cloth over his head to cover his entire body, leaving the left eye uncovered. This was also the explanation of the word 'Alaihinna in this verse" (Commentary by Ibn Jarir and Ahkam-ul-Quran, Vol.3, p.457 also in "hijaab wa Safur" quoted by Shaikh AbdulAziz Bin Bazz under the chapter of his fatwaa on hijab on page #54)
From the Tabi 'een..
Hassan Al Basri (Rahimahullah)
States in his tafseer of the Surah An-Nur, "What a woman is allowed to show in this Ayah implies to those outer garments (not the face or hands) which the woman puts on to cover her internal decoration (her beauty).
(Quoted in the book "Purdah" P#194 )
Ibn Jarir (Rahimahullah) Quotes the opinion of Ibn Ábbaas (Radhiallaahu Ánhu)
"Allah has enjoined upon all Muslim Women that when they go out of their homes under necessity, they should cover their faces by drawing a part of their outer garments over their heads." (Tafseer Ibn Jarir, VOL 22, pg.29)
The Tabi'ee, Qatadah (Rahimahullah)
Stated that the Jilbab should be wrapped and fixed from above the forehead and made to cover the nose, (although the eyes are to show) and the chest and most of the face are to be covered.
The Tabi'ee Ali bin Abu Talha (Rahimahullah)
Quotes from Ibn Abbaas (Radhiallaahu Ánhu) that he used to say it was allowed to show the hands and face when Surah Nur ayah #31 was revealed but after Surah Al-Ahzaab, Verse #59 with the word "Jalabib" was revealed then after this Ibn Abbaas (Radhiallaahu Ánhu) said that That the Muslim women are ordered to cover their head and faces with outer garments except for one eye." And this was also the opinion of Ibn Mas'ud (Radhiallaahu Ánhu). (This is quoted by Ibn Taymiyyah (Rahimahullah) in his book of fatwaa and by Shaikh AbdulAziz Bin Bazz (Rahimahullah) in the book "Hijaab wa Safur" Page # 60)
Imam Muhammad bin Sirin (Rahimahullah) One of the most knowledgeable tabi'een)
"When I asked Ubaida bin Sufyan bin al-Harith ('Radhiallaahu Ánhu' Other well known and knowledgeable Companion of Rasulullah) the meaning of this verse about "Alaihinna" and how the jalbaab was to be worn, he demonstrated it to me by pulling a sheet of cloth over his head to cover his entire body, leaving the left eye uncovered. This was also the explanation of the word 'Alaihinna in this verse"(Commentary by Ibn Jarir and Ahkam-ul-Quran, Vol # 3, p.457 also in "hijaab wa Sufor" quoted by Shaikh AbdulAziz Bin Bazz under the chapter of his fatwaa on hijab on page #54)
From the Mufasireen of Quraan...
The Mufassir, Imaam Al-Qurtubi (Rahimahullah),
Cites in his Tafseer of the Ayah on Jilbaab (Al-Ahzab 33:59), that the Jilbaab is: "a cloth which covers the entire body... Ibn 'Abbaas (Radhiallaahu Ánhu) and 'Ubaidah As-Salmaani (Radhiallaahu Ánhu) said that it is to be fully wrapped around the women's body, so that nothing appears but one eye with which she can see." (Tafseer Al-Qurtubi Surah Al-Ahzab ayah # 59. This was also agreed upon by Imam WahidiImam Neishapuri in the book of tafseer of Quran "Gharaib -ul-Quran" and "Ahkam-ul-Quran", Imam Razi, in his tafseer of Surah Azhab in the book "Tafsir-i-Kabir" Imam Baidavi in his tafseer of Quran "Tafsir-i-Baidavi" and by Abu Hayyan in "Al-Bahr-ul-Muhit" and by Ibn Sa'd Muhammad bin Ka'b Kuradhi and they have all descirbed the use of jalbaab more or less in the SAME way as the two described by Ibn Abbas (Radhiallaahu Ánhu).)

Also from Imaam Qurtubi (Rahimahullah)
in his Al-Jamia li Ahkaamul Qurãn states: "All women are in effect covered by the terms of the verse which embraces the Sharée principle that the whole of a woman is to be concealed; her face, body and voice, as mentioned previously. It is not permissible to expose those parts except in the case of need, such as the giving of evidence ("Al-Jamia li Ahkaamul Qurãn")
At-Tabari and Ibn Al-Mundhir
described the method of wearing the jalbaab according to Ibn Abbas (Radhiallaahu Ánhu) and Qatadah (Radhiallaahu Ánhu). The sheet should be wrapped around from the top, covering the forehead, then bringing one side of the sheet to cover the face below the eyes so that most of the face and the upper body is covered. This will leave both eyes uncovered (which is allowed in necessity).(Rul-ul-Ma'ani, Vol 22, p.89)
Ibn Kathir (Rahimahullah) said...
"Women must not display any part of their beauty and charms to strangers except what cannot possibly be concealed." (Quoted by Mufti Ibrahim Desi in his article on hijaab)
Maoulana Abul A'la Maududi (Rahimahullah) In his tafseer of Surah Azhab ayah #59
"In verse 59 the third step for social reform was taken. All the Muslim women were commanded that they should come out well covered with the outer garments and covering their faces whenever they came out of their houses for a genuine need." (From Tasfeer of Quran by Maoulana Abul A'la Maududi in tafseer of ayah # 59 of Surah Al-Ahzaab)
From the 4 Madhabib (4 madhabs).......
Mufti Anwar Ali Adam Al Mazahiri (Mufti A'azam (Head Mufti) of Madrasa Madinatil Uloom Trinidad & Tobago.)
"Imam Shafi, Malik & Hambal hold the view that Niqaab (covering the face, the hands completely with only a small area for the eyes to see) as
being compulsory (fard). Imam Abu Hanifa says that niqaab is Wajib and the face and hands can be exposed provided that there is not fear of desire if one looks at the female face, otherwise if there is the slightest chance of desire developing in the looker (the meaning of desire is that the looker would see the female face and think that she is beautiful, sexual thaught is not what is meant) then exposing the face and hands is Haraam.
(This is from the fatwaa issued by Mufti Anwar Ali Adam Al Mazahiri on 13/9/99. He derived the opnions of the 4 Imaams from these sources Tafseer Ibn Katheer, Tafseer Ma'rifatul Qur'aan, Durre Muhtaar, Fatawa Shami, Al Mabsoot, Fathul Qadeer. And the opinion of Imaam Abu hanifah is a directly derived from his statements in the Famous book of hanafi Fiqh Fatwaa Shami)
Explained in his tafseer of Surah Al-Ahzaab, Verse #59. "Allah Ta'ala is telling them that whenever out of necessity they have togo out, they should cover themselves with a large cloak and draw a corner of it over their faces so that they may not be recognised.
From the known and respect authentic Ullima.......
Ibn Al-Hazam (Rahimahullah)
"In arabic language, the language of the Prophet (saw), the word jilbaab (as mentioned in the Quran Surah Ahzaab ayah # 59) means the outer sheet which covers the entire body. A sheet smaller than that which would cover the entire body, cannot be catagrized as jilbaab. (Al-Muhallah, Vol 3. Pg 217)
Ibn Al-Mandhur (Rahimahullah)
"Jalabib is plural for Jilbaab. Jalbaab is actually the outer sheet/coverlet which a woman wraps around, on top of her garments to cover herself from head to toe. This covers the body entirely." (Lisan ul-Arab, VOL 1. Pg.273)
Ibn Hajar Al-Asqalanee (Rahimahullah)
A tradition reported on the authority of Aisha (Radhiallaahu Ánha) says: "A woman in a state of Ihram (during Hajj and Umrah) should stretch her head cloth over to her face to hide it." (In Fathul Bari, chapter on Hajj)
Shaikh-ul-Islam Ibn Taymiyyah (Rahimahullah) relates:
"Women used to room about without Cloaks (Jilbaabs) and men used to see their faces and hands, but when the verse stating 'O Prophet! Tell your wives and your daughters and the women of the believers to draw their cloaks over themselves.' (Surah Al-Ahzaab,Verse #59)was reveled, then this was prohibited and women were ordered to wear the Jilbaab. Then Ibn Tayimiyyah goes on to say "The word Jilbaab means a sheet which Ibn Mas'ud (Radhiallaahu Ánhu) explained as a cloak covering the entire body including the head, face and hands. Therefore, it is not permissible for the women to reveal the face and hands in public. (Ibn Taymiyyah's book on fatwaas Page# 110 Vol # 2 also in the book Hijaab Page # 15)
Imaam Ghazaali (Rahimahullah) "Woman emerged (during the time of Rasulullah (Sallallaahu Álayhi Wasallam) with NIQAABS on their Faces" (From his famous book of Fiqh "Ihyaal Uloom")
Qazi Al-Baidavi (Rahimahullah)
"to let down over them a part of their outer garments" means that they should draw a part of their outer garment in front of their face and cover themselves" (Tafsir-I-Baidavi, Vol 4, p.168)
Jamia Binoria Pakistan (This is a Question and Answer from a Mufti at one the highly respected hanafi Islamic Universites of Pakistan)
Ques: Under which conditions are women allowed to leave the home?
Ans: The principle command for women is that they should remain in their home and should not go out without any extreme need because mischief is feared in their going out. However if they have to go out in extreme necessity then they should go with a Mahram and duly covered in Burqa' (a "Burqa" covers the whole body including the hands and face) or large overlay so that their body including their cloths should not be visible and after buying the required article they should come back at once. In this condition there is no Haraam.

It is also stated in the Famous books of Fiqh Durrul Mukhtar...
"Young women are prohibited from revealing their faces in the presence of men."

Hakimul Ummah Maulana Ashraf Ali Thanvi (Rahimahullah) states in his famous book of Hanafi Fiqh "Bahishti Zewar."

"It is not permissible for a young woman to expose her face in the presence of ghayr mahrams, nor should she stand in a place where she could be observed. We learn from this, that the custom of exposing the bride's face in public where all the men can observe her is also not permissible. To do so is a major sin." (Bahishti Zewar)

Question: What is the Islamic hijab?

Response: The Islamic hijab is for the women to cover everything that is forbidden for her to expose. That is, she covers everything that she must cover. The first of those bodily parts that she must cover is her face. It is the source of temptation and the source of people desiring her. Therefore, the woman must cover her face in front of those men that are not mahram. As for those of who claim that the Islamic hijab is to cover the head, shoulders, back, feet, shin and forearms while allowing her to uncover her face and hands, this is a very amazing claim. This is because it is well known that the source of temptation and looking is the face. How can one say that the Shariah does not allow the exposure of the foot of the woman while it allows her to uncover her face? It is not possible that there could be in the Esteemed, Wise and Noble Shariah a contradiction.( 'Islamic Fatwas regarding Women' Page # 289)

MAY ALLAH HELP US FIND THE PERFECT WIFE, DESTINED FOR US INSHALLAHUTALAH BY THE GRACE OF ALLAHU AKBAR- AMEEN

That's the way it has to be because that's the way our RasoolSallAllahwalay-hee wa Salim,liked it!!! in Sha ALLAH-Mash-ALLAH-Subnan-ALLAH-Wal-Hamdullillahee wa La eelaha Ill ALLAHU waLa hu AKBar- walah Howla wa la Quwatta illa Billahil Aleeyul Azeem!!!
 
 
Hadruth Nuh Alaih Salaam ka Waqiyah 

http://www.yourbodycode.com/blog/All/how-to-get-rid-of-dark-spots-_and_-hyperpigmentation

I've made his Ziyarah in Misr
AlBadawi.jpg
Recite Fatiha for the Best in Tanta, Misr
tellibaba.jpg
medina.jpg
kardanee.jpg

duakaab.jpg

iloveallthekhaleefasmashallah.jpg

nalayn.jpg

abudardarahmuthallahalaihmadethisdua.jpg
salawaathofalghawthaladhaameeradeeallahuanhu.jpg
towbah.jpg

goodgirlgiveszakaat.jpg

tahajjuddua.jpg

بِسْمِ اللَّهِ الرَّحْمَـٰنِ الرَّحِيمِ ۞ وَقَالَ ارْكَبُوا فِيهَا بِسْمِ اللَّهِ مَجْرَاهَا وَمُرْسَاهَا ۚ إِنَّ رَبِّي لَغَفُورٌ رَّحِيمٌ إِنَّهُ مِن سُلَيْمَانَ وَإِنَّهُ بِسْمِ اللَّهِ الرَّحْمَـٰنِ الرَّحِيمِ ربنا ولك الحمد حمدا كثيرا طيبا مباركا فيه، ربنا ولك الحمد حمدا كثيرا طيبا مباركا فيه ملء السماوات والأرض وما بينهما الخطبة الأولى: بسم الله الرحمن الرحيم. الحمد لله الذي جعل يوم الجمعة سيد الأيام. ولا نعبد ولا نستعين إلا به. وهو الذي فرض صلاة الجمعة. فسارعوا إلى ذكر الله (القرآن 62: 9). والصلاة والسلام على سلطان الانبياء سـيـدنـا مولانا محمد رسـول الله سيد البشر وعلى آله وصحبه الكرام. وخاصة خير البشر بعد الأنبياء بالحق أمير المؤمنين أبو بكر الصديق. والصديق الصادق الصالح أمير المؤمنين عمر بن الخطاب. وصاحب كمال الحياء والإيمان أمير المخلصين عثمان بن عفان. وأعظمهم انتصاراً أمير المؤمنين علي بن أبي طالب. وعلى الإمامين الشهيدين الحسن والحسين وأمهما سيدة الصالحات فاطمة الزهراء. وعلى السيدين الشريفين الطهرين الحمزة والعباس. وعلى الباقين من العشرة المباشرة (العشرة جناتي الصحابة) من الصحابة والتابعين. رضي الله عنهم جميعا. نفعنا الله بالقرآن وآياته وذكره الحكيم. كتاب الآداب للإمام البيهقي بِسْمِ ٱللَّهِ ٱلرَّحْمٰنِ ٱلرَّحِيماللَّهُمَّ صَلِّ وَسَلِّمْ وَبَارِكْ عَلَى سَيِّدِنَا مولانا مُحَمَّدٍ النُّورِ الذَّاتِيِّ وَالسِّرِّ السَّارِيِّ فِي سَائِرِ الْأَسْمَاءِ وَالصِّفَاتِ عَدَدَ مَا فِي عِلْمِ اللهِ صَلاَةً دَائِمَةً بِدَوَامِ مُلْكِ الله اُوصيكُما بِتَقوَى اللهِ، وألّا تَبغِيَا الدُّنيا وإن بَغتَكُما، ولا تَأسَفا عَلى شَيءٍ مِنها زُوِيَ عَنكُما، وقولا بِالحَقِّ، وَاعمَلا لِلأَجرِ، وكونا لِلظّالِمِ خَصمًا، ولِلمَظلومِ عَونًا. اُوصيكُما وجَميعَ وُلدي وأهلي ومَن بَلَغَهُ كِتابي بِتَقوَى اللهِ، ونَظمِ أمرِكُم وصَلاحِ ذاتِ بَينِكُم؛ فَإِنّي سَمِعتُ جَدَّكُما صلى الله عليه وآله يَقولُ: (صَلاحُ ذاتِ البَينِ أفضَلُ مِن عامَّةِ الصَّلاةِ وَالصِّيامِ) In response to the accusations that Tawassul (from waseela) doesn't exist, see how a shirt cures blindness: . ﭐﺫْﻫَﺒُﻮﺍْ ﺑِﻘَﻤِﻴﺼِﻰ ﻫَـٰﺬَﺍ ﻓَﺄَﻟْﻘُﻮﻩُ ﻋَﻠَﻰٰ ﻭَﺟْﻪِ ﺃَﺑِﻰ ﻳَﺄْﺕِ ﺑَﺼِﻴﺮﺍً ﻭَﺃْﺗُﻮﻧِﻰ ﺑِﺄَﻫْﻠِﻜُﻢْ ﺃَﺟْﻤَﻌِﻴﻦَ "Take this my shirt & cast it on my father's face, he will (again) be able to see, & come to me with all your families." (Surah Yusuf Alay Salaam 12:93) 1. The shirt is 'Dead' but it can cure? I advise you to fear ALLAH, & don't desire the world, even if it desires you, & not to feel sorry for any of it that has been withheld from you, speaking the truth, working for reward, being an adversary to the oppressor & a helper to the oppressed. I advise you, my family, & whomever my letter reaches, to fear ALLAH, organize your affairs, being reconcilable among yourselves. Reconciliation between 1 another is better than general prayers & fasting) Ya Allah,send Blessings upon Muhammad ﷺ & the Family of Muhammad ﷺ, in the name of your Most Special Dignity in your Exalted Majesty, in the name of the Greatness of your Ismay-Dhhaat, in the name of the Purity of your Prophets, in the name of the light of your chosen representatives, in the name of the Blood shed by the martyrs in your cause, in the name of the ink used by the scholars of your plans, in the name of the prayers of the Righteous & in the name of the invocations made by your servants living in resignation & asceticism. We beseech you for enhancement in knowledge,freedom from sickness in the body,long duration of life spent in your obedience, with abundance in the means of livelihood, Divine guidance to turn repentant unto you, before death, freedom from pain at the time of death, protection after death,light in the grave, escape from hell, entry into Paradise & safety from all the evils of the world & from your chastisement in the hereafter, in thy name & for the sake of Muhammad ﷺ his family & all the Best Prophets & Messengers. May Allah وَلَهُ الْكِبْرِيَاۤءُ فِى السَّمٰوٰتِ وَالْاَرْضِ ۗوَهُوَ الْعَزِيْزُ الْحَكِيْمُ ࣖ ۔ ( الجاثية: ٣٧ ) also grant us the wealth to make our Grandmother رضی اللہ عنھا الجدة بيبي المدينة proud of us by constructing in Baghdad مسجد الشيخ عبد الرزاق الجيلاني a Masjid, which will house the mausoleum قبر ممتاز of her son رحمة الله عليه & our Grandfather, because السلطان الفقر تاج الدين أبو بكر عبد الرزاق الجيلاني رضي الله عنه assisted his father in compiling the lectures found in their books: PURIFICATION OF THE MIND (JILA' AL-KHATIR) The Removal of Cares:(Jala' al-Khawatir). Sultan Al-Faqr تاج الدين AbuBakr-حضرة عبد الرزاق Jilani Al-Hasani عَلَيْهِ ٱلصَّلَاةُ وَٱلسَّلَامُ inherited the Maqām of Al-Faqr (the soul of Islam which was gifted to أَنَّ النَّبِيَّ صلى الله عليه وسلم on لیلة المعراج) from his father through blood relations as well as good fortune. سيدنا الشيخ عبد القادر الجيلاني رضي الله عنه transferred his entire spiritual knowledge & Holy Powers to his son تاج الدين عبد الرزاق الجيلاني Tāj al-Dīn (Crown of the Religion) , رحمة الله عليه السلطان الفقر. Hence, he was the mirror image of his Dad. Therefore we should make it our goal in life to financially aid in building a Masjid that shall house قبر السلطان الفقر حضرة أبو بكر أبو الرزاق سيدنا الشيخ تاج الدين بن عبد القادر الجيلاني رضي الله عن, in a more beautiful جميل style then the present مزار اقدس حضور السلطان الفقر سیدنا تاج الدين عبد الرزاق الجيلاني رحمة الله عليه بغداد شریف, just as fabulously as the Mevlânâ Müzesi, in Konya, Turkey, & مزار غوث ٱلْحَضْرَة جيلانيا ٱلْقَادِرِيَّة بَاب ٱلشَّيْخ, مزار اقدس حضور سیدنا شیخ عبدالقادر جیلانیؓ مزار غوث in بغداد شریف رَبَّنَا تَقَبَّلْ مِنَّآ ۖ إِنَّكَ أَنتَ ٱلسَّمِيعُ ٱلْعَلِيمُ أَسْأَلُكَ بِاسْمِكَ الْكَبِيْرِ وَ نُوْرِ وَجْهِكَ الْمُنِيْرِ وَ بِمُلْكِكَ الْقَدِيم يَا حَيُّ يَا قَيُّوْمُ يَا حَيُّ يَا قَيُّوْمُ يَا حَيُّ يَا قَيُّوْمُ اَللَّهُمَّ صَلِّ وَسَلِّمْ عَلىٰ سَيِّدِنَا مُحَمَّدٍ نبي الرحمة صلى الله عليه وسلم❁ قَدْ ضَاقَتْ حِيلَتِي أَدْرِكْنِي يَا رَسُولَ اللهِ ـ صلى ـ صلى الله عليه وسلم ـ ـ❁ وَ يَا حَيُّ لا إِلٰهَ إِلا أَنْتَ صَلِّ عَلٰى جدي صاحبول عينيل كمالي مُحَمَّدٍ (ﷺ) وَ آلِ مُحَمَّدٍ مصطفى ـ صلى الله عليه وسلم ـ اللَّهُمَّ إِنِّي أَسْأَلُكَ مِنَ الْخَيْرِ كُلِّهِ عَاجِلِهِ وَآجِلِهِ مَا عَلِمْتُ مِنْهُ وَمَا لَمْ أَعْلَمْ وَأَعُوذُ بِكَ مِنَ الشَّرِّ كُلِّهِ عَاجِلِهِ وَآجِلِهِ مَا عَلِمْتُ مِنْهُ وَمَا لَمْ أَعْلَمْ اللَّهُمَّ إِنِّي أَسْأَلُكَ مِنْ خَيْرِ مَا سَأَلَكَ عَبْدُكَ وَنَبِيُّكَ وَأَعُوذُ بِكَ مِنْ شَرِّ مَا عَاذَ بِهِ عَبْدُكَ وَنَبِيُّكَ اللَّهُمَّ إِنِّي أَسْأَلُكَ الْجَنَّةَ الفردوس علاء وَمَا قَرَّبَ إِلَيْهَا مِنْ قَوْلٍ أَوْ عَمَلٍ وَأَعُوذُ بِكَ مِنَ النَّارِ وَمَا قَرَّبَ إِلَيْهَا مِنْ قَوْلٍ أَوْ عَمَلٍ وَأَسْأَلُكَ أَنْ تَجْعَلَ كُلَّ قَضَاءٍ قَضَيْتَهُ لِي خَيْرًا May Allah جل شانه Bestow upon us the same Good Fortune that shall bring Gifts of Wisdom as asked by رحمة الله عليه حذرت عبدالقادر الجيلاني the Beloved Grandson of “The Mercy Gifted to Creation,” An-Nabi ar-Rahmah al-Mughdad ﷺ the سلطان الرجال of Baghdad, محبوب سبحانی شیخ عبدالقادر جیلانی رحمتہ اللہ علیہ تبارك الله، لطف الله وكرمه جعل حياتنا سهلة اللَّهُمَّ صَلِّ عَلَى مُحَمَّدٍ وَآلِ مُحَمَّدٍ ، اللَّهُمَّ بِعَزَّتِكَ الْخَاصِّ فِي جَلَالِكَ الْمُعْلَى مَدَدْ يا الله اللهم صل وسلم وبارك على سيدنا محمد نبي رحمة وأزواجه وعلى آله وصحبه وا ذريتي بركاتيل كريم الاجمايين وسلم تسليما عدد كمال الله و كما يليق بكماله Hadeethay- Shareef about حَضْرَة Ali كَرَّمَ اللهُ وَجْهَه My Ultimate Grandfather Afdalay کایٔنات سیدنا مُحَلّلُ المشکلات صلی اللّٰہ علیہ وآلہ وسلّم Mustafa حَضْرَة كَرَّمَ اللهُ وَجْهَه رضي الله ﺗﻌﺎﻟﯽٰ عنه, رسول الله صَلَّى ٱللَّٰهُ عَلَيْهِ وَسَلَّمَ declared: يا علي عَلَيْهِ ٱلصَّلَاةُ وَٱلسَّلَامُ , your body is my body, يا علي عَلَيْهِ ٱلصَّلَاةُ وَٱلسَّلَامُ your flesh is my flesh, يا علي عَلَيْهِ ٱلصَّلَاةُ وَٱلسَّلَامُ your blood is my blood,يا علي عَلَيْهِ ٱلصَّلَاةُ وَٱلسَّلَامُ your soul is my soul. ALLAH has created Me & حَضْرَة علي عَلَيْهِ ٱلصَّلَاةُ وَٱلسَّلَامُfrom the same Noor (Light). [Ana Madinatul ilm wa Aliyun babuha] I'm the city of knowledge & حَضْرَة علي عَلَيْهِ ٱلصَّلَاةُ وَٱلسَّلَامُ is it's gate [ALI O MINNI WA ANA MINAL ALI ] ALI is from Me & I'm from Ali [Man Kunto Maula Fahaza ALI un Maula] Whoever accepts Me as a Master,حَضْرَة علي عَلَيْهِ ٱلصَّلَاةُ وَٱلسَّلَامُ is his Master too [Al Haqqo Ma’al ALI wa Aliyo Ma’al Haqq] ‘Haq stands with ALI & ALI stands with Haq علي مع القرآن والقرآن مع علي علي علي سالم is with the Quran & the Quran is with حَضْرَة علي عَلَيْهِ ٱلصَّلَاةُ وَٱلسَّلَامُ. Ya’ الله جل جلاله turn the Haq with him wherever حَضْرَة علي عَلَيْهِ ٱلصَّلَاةُ وَٱلسَّلَامُ turns. حَضْرَة علي عَلَيْهِ ٱلصَّلَاةُ وَٱلسَّلَامُ is My brother in this world & in the hereafter.أنت أخي في الدنيا والآخرة حَضْرَة علي عَلَيْهِ ٱلصَّلَاةُ وَٱلسَّلَامُ you are my brother & the father of My sons Looking at حَضْرَة علي عَلَيْهِ ٱلصَّلَاةُ وَٱلسَّلَامُ’s face is Ibadah. Talking about حَضْرَة علي عَلَيْهِ ٱلصَّلَاةُ وَٱلسَّلَامُ (in your gatherings & meetings) is Ibadah. One who keeps enmity & jealousy with حَضْرَة علي عَلَيْهِ ٱلصَّلَاةُ وَٱلسَّلَامُ will never enter paradise. Obedience of حَضْرَة علي عَلَيْهِ ٱلصَّلَاةُ وَٱلسَّلَامُ is My obedience & his disobedience is My disobedience. حَضْرَة علي عَلَيْهِ ٱلصَّلَاةُ وَٱلسَّلَامُ is to Me as هارون علي السلام was to موسى علي السلام, though there will be no prophet after Me. حَضْرَة علي ٱلصَّلَاةُ وَٱلسَّلَامُ كَرَّمَ اللهُ وَجْهَه spoke about the bravery of the Best حَضْرَة Prophet of کایٔنات-Mankind رسول الله صَلَّى ٱللَّٰهُ عَلَيْهِ وَسَلَّمَ & said, 'When the fighting in Jihad would intensify & the 2 sides would meet in battle, we would seek shelter & protection with رسول الله صَلَّى ٱللَّٰهُ عَلَيْهِ وَسَلَّمَ — & no one was closer to the enemy than him !'حَضْرَة Anas رضي الله ﺗﻌﺎﻟﯽٰ عنه said that there was once an extremely loud noise which alarmed everyone at night so the men headed towards that direction. Whilst they were headed there, they saw رسول الله صَلَّى ٱللَّٰهُ عَلَيْهِ وَسَلَّمَ got there before them. He was fearlessly riding a horse without a saddle with a sword around his neck, & he was saying, 'Don't be alarmed! حَضْرَة Anas رضي الله ﺗﻌﺎﻟﯽٰ عنه then said, رسول الله صَلَّى ٱللَّٰهُ عَلَيْهِ وَسَلَّمَ was the bravest most courageous of people. Praise is due to الله سبحانه وتعالى who made me the Grandson of the Best in کایٔنات the Universe of الله سبحانه وتعالى سبحان الله وبحمده سبحان الله العظيم أعوذُ بِٱللَّهِ مِنَ ٱلشَّيۡطَٰنِ ٱلرَّجِيمِ بسم الله الرحمن الرحيم Nahmaduhu Wa Nusalli Ala حَضْرَة Rasool-الله جل جلاله al-Kareem رحمة الله عليك وأسكنك فسيح جناته بارك الله فيكم وجزاكم الله خيرا~`أما بعد ﷽ - الصــلوة والسلام‎ عليك‎ ‎يارسول‎ الله ﷺ السَّلَامُ عَلَيْكُمْ wa Raḥmatullāhee wa Barakātuh wa Maghfiratahu. استغفر الله العظيم الذي لا إله إلا هو الحي القيوم واتوب اليه عدد خلقه ورضا نفسه وزنة عرشه ومداد كلماته رحمة الله عليك وأسكنك فسيح جناته Aṣ-Salātu wa Salāmu ‘alá يَا رَسُولُ الله حَضْرَة Rasūlināسیدنا مُحَلّلُ المشکلات صلی اللّٰہ علیہ وآلہ وسلّم Muḥammadin Sayidil الأنبياء Wal Mursaleen Afdala Awwalīna wal-Akhireen قدس الله سره العزيز مَدَد Yā RasūlAllāh صلى الله عليه وسلم كرم الله وجهه,يا Rahmuthullil Alameen, مدد يا أنبياء الله يا مدد Yā Sādāti Aṣḥāabee Rasool-الله جل جلاله, مدد Ya أَمِيْر ٱلْمُؤْمِنِيْن حَضْرَة عمر مدد يا أمير المؤمنين عمر بن عبد العزيز مدد يا عثمان ذو النورین مدد يا محمد بن قاسم عبدكَرَّمَ اللهُ وَجْهَه مدد يا أسد الله غالب عَلِيّ بْن أَبِي طَالِب كَرَّمَ اللهُ وَجْهَه مدد يا حضرت عباس علمدار علیہ السلام كَرَّمَ اللهُ وَجْهَه العزيز, مدد Yā Mashāyikhinā, داستور يا الحضرة القادرية خير زورياتي مصطفى صلى الله عليه وآله وسلم المقدسة المدد یا غوثِ اعظم Ya هَيْكَل‎ سمدانی سلطان محيي الدين سيف الله المدد یا غوثِ اعظم المددسگیر قطب رَبَّانِيّ محبوب سُبحانی شریف عبدالقادر الجيلاني الحسني شیخ حضرت سیدنا غوث الاعظم كرم الله وجهه یَا شَیْخُ عَبْدَالْقَادِرِ شَیْئًا لِلّٰه, Al مدد Ya حَضْرَة قدس الله سره العزيز Be-Iznillah, يا ابو حامد محمد بن محمد الغزالى, يا Shah أحمد الرفاعية, يا Sidi أحمد تيجاني, مَدَد يا Sakhi-شہباز قلندر, يا مولانا Hadaadee, يا شمس الدين Tabrizi مَدَد يا مولاناحَضْرَة Roomee رحمة الله عليه, يا نورالدین Jerrahee المداد يا حضرة خواجة بهاء الدين شاه نقشبند Al-مَدَد يا أحمد Al-Badawee نورلهدا مدد يا سيدي البدوي جاب اليسرَ اللَّهُمَّ صَلِّ وَسَلِّمْ وَبَارِكْ عَلَى سَيِّدُنَا وَمَوْلاَنَا مُحَمَّدٍ شَجَرَةِ الأَصْلِ النُّورَانِيَّةِ وَلَمْعَةِ الْقَبْضَةِ الرَّحْمَانِيَّةِ وَأَفْضَلِ الْخَلِيقَةِ الإِنْسَانِيَّةِ وَأَشْرِفِ الصُّورَةِ الْجِسْمَانِيَّةِ وَمَعْدِنِ الأَسْرَارِ الرَّبَّانِيَّةِ وَخَزَائِنِ الْعُلُومِ الإِصْطِفَائِيَّةِ صَاحِبِ الْقَبْضَةِ الأَصْلِيَّةِ وَالْبَهْجَةِ السَّنِيَّةِ وَالرُّتْبَةِ الْعَلِيَّةِ مَنِ انْدَرَجِتِ النَّبِيُّون تَحْتَ لِوَائِهِ فَهُمْ مِنْهُ وَإِلَيْهِ وَصَلِّ وَسَلِّمْ وَبَارِكْ عَلِيْهِ وَعَلَى آلِهِ وَصَحْبِهِ عَدَدَ مَا خَلَقْتَ وَرَزَقْتَ وَأَمَتَّ وَأَحْيَيْتَ إِلَى يَوْمِ تَبْعَثُ مَنْ أَفْنَيْتَ وَسَلِّمْ تَسْلِيماً كَثِيراً وَالْحَمْدُ لله رَبِّ الْعَالَمِينَ. اَللّٰهُمَّ إنِّيْ أَسْأَلُكَ إيْمَانًا دَائِمًا وَ أَسْأَلُكَ قَلْبًا خَاشِعًا وَ أَسْأَلُكَ عِلْمًا نَافِعًا وَ أَسْأَلُكَ يَقِيْنًا صَادِقًاوَ أَسْأَلُكَ دِيْنًا قَيِّماً وَ أَسْأَلُكَ الْعَافِيَةَ مِنْ كُلِّ بَلِيَّةٍوَ أَسْأَلُكَ تَمَامَ الْعَافِيَةِ وَ أَسْأَلُكَ دَوَامَ الْعَافِيَةِوَ أَسْأَلُكَ الشُّكْرَ عَلَى الْعَافِيَةَ وَ أَسْأَلُكَ الْغِنٰى عَلَى النَّاسِ اللهم آمين يا رب العالمين May الله سبحانه وتعالى عز و جل grant us all a visit to the داتا دربار of ابوالحسن علی بن عثمان الجلابی الھجویری (Bestower of Spiritual Treasures) who is grace to our world; a manifestation of الله سبحانه وتعالى's Noor. A perfect Spiritual Guide for imperfect people as well as a guide for perfection, for even the perfect, إِنْ شَاءَ ٱللَّٰهُ عَلَيْهِ ٱلصَّلَاةُ وَٱلسَّلَامُ مَدَد يا علي Al- مَدَد يا حضرت سید علی عَلَيْهِ ٱلصَّلَاةُ وَٱلسَّلَامُ داتا گنج بخش رحمت اللہ علیہ Ganj Bakhsh-e-Faiz-e-Alam Mazhar-e-Nur-e-Khuda,الله سبحانه وتعالى Na Qasaan-ra Peeray-Kamil-Kamilaan-ra Rahnuma گنج بخش فیضِ عالَم مظہرِ نورِ خدا ناقصاں را پیرِ کامل ، کاملاں را راہنما, مَدَد يا مسعود گنج شکر حضرت بابا فرید الدّین ,مَدَد يا غریب نواز , مَدَد يا خادم الطريقة القادرية لابالی جد كورنول مَدَد يا عبد اللطيف يا إبراهيم الدسوقي , يا أبو الحسن الشاذلي مَدَد يَا أستاذ نقشبند شيخ مصطفى ,ياشاه نقشبندى مَدَد يا مجدد Alfa Sani أحمد SirrHindi, مَدَد يا الأنبياء مَدَد يا أنبياء البنجاب Punjab مَدَد, Al-مدد يا أُوَيْس أحمد ولِيُ اللہ, مَدَد يا Shayk نور حسين مدد مَدَد يا اَوْلِيَاۤءَ اللّٰ يا حَضْرَة خضر, مَدَد يا عبدالغني النابلسي,يا محيي الدین أبو عبد الله محـمـد بن العربي الطائي الحاتمي الشيخ الأكبر يا ابن عربي قدس الله سره العزيز, مَدَد يا سيفضين يحيى الحموي قدس الله سره العزيز, مَدَد يا تيلي بابا عبد الله قدري قدس الله سره العزيز يا حَضْرَة مَدَد يا بابا مخدوم صابر کلیری مدد يا حضرت شاه نعمت الله ولي Vali Ṭarīqatunā aṣ-Suḥbah wal-Khayru fil-Jam‘iyyah. مدد مدد … اللهم صل وسلم وبارك على سيدنا محمد وعلى آل سيدنا محمد عدد كمال الله وكما يليق بكمالهMay الله سبحانه وتعالى عز و جل Grant them all مَدَد & Shafa’at الكبرى of سیدالخلق ﷺ & elevate our ranks with theirs in جنّات الفردوس Ala.رب العالمين يهبهم جميعا مكانة عالية في جنة الفردوس امين رب العالمين. May we be granted مَدَد that shall give us a High Maqaam in جنتل فردوس على without questioning & may we be granted in this worldly life أعظم الزوجات & النسل that shall شرف our القرب by the حَوْضُ ٱلْكَوْثَرِ of أفضل خالق ﷺ اللهم إني اسألك الفردوس الأعلى من الجنة لي ولوالدي ومن أحبب من خلقك اللَّهُمَّ إِنِّي أَسْألُكَ بِرَحْمَتِكَ الَّتِي وَسِعَتْ كُلَّ شَيٍْء يا الله رب عزت I ask you for the الأعلى مقامات in جنّات الفردوس Ala for myself, my parents & those I LOVE from Your creation.رَبَّنَا تَقَبَّلْ مِنَّا إِنَّكَ أَنتَ السَّمِيعُ الْعَلِيمُ Telli Baba نفعنا الله be is a مرشد of the القادريه Sufi Brotherhood. اللهم ارحمني يا ارحم الراحمين, May الله سبحانه وتعالى عز و جل guide the young beauties-cuties visiting his tomb making Duas for Nikah to a Loving Husband like me by the Blessed Truth of the Ayat 40:60 from Surah Ghafir: وَقَالَ رَبُّكُمُ ٱدْعُونِىٓ أَسْتَجِبْ لَكُمْ ۚ إِنَّ ٱلَّذِينَ يَسْتَكْبِرُونَ عَنْ عِبَادَتِى سَيَدْخُلُونَ جَهَنَّمَ دَاخِرِينَ ٦٠, & يا الهي ذُو ٱلْجَلَالِ وَٱلْإِكْرَامُ join us with خير أولياء الله in جنتل فردوس على : وَالْفِرْدَوْسُ أَعْلَى الْجَنَّةِ وَأَوْسَطُهَا وَفَوْقَ ذَلِكَ عَرْشُ الرَّحْمَنِ وَمِنْهَا تُفَجَّرُ أَنْهَارُ الْجَنَّةِ فَإِذَا سَأَلْتُمُ اللَّهَ فَسَلُوهُ الْفِرْدَوْسَ Al-Firdose is the highest of Paradise & its most expansive, & above that is the Throne of الله جل جلاله Ar-Rehmaan (the Most Beneficient), & from it the rivers of Paradise are made to flow forth. So when you ask الله سبحانه وتعالى, ask Him for الفردوس .” نفعنا الله و إياكم به إنه نعم المولى ونعم النصير إن شاء الله تقابل دعاء يا رب -امين يا الله بهورماتي لااله الا الله الملك الحق المبين محمد رسول الله صادق الوعد الأمين وباركاتي سر سورة الفاتحة ٱلْفَاتِحَة‎ wa Be محمودayصلى الله عليه وسلم: اللَّهُمَ صَلِ وَسَلِّمْ وَباَرِكْ عَلَ حذرت سَـيّدِنا مرشد مُحَمَد ﷺ صَلاةً تُوصُلُنا إِليهْ وَتَجمَعُنَا عَلَيه وتُقَرِبُنَا لِحَضرَتِهِ وَتُمَتِعُنَا بِرُؤيَتِهِ فَنُشَاهِدُهُ عَيَانَاًو وَنَراهُ يَقَظَةً وَمَنَامَاً وَتَقَعٌ عَيّنُ قُلُوبُنَا عَلَى عَيّنِ ذَاتِهِ وَنَحظَى بِعَطفِهِ وَنَفُوزُ بِمُنَاجَاتِهِ وَاْهْدِنَا بِنُورِكَ نُورُ الّيَقِينْ وَأَيْدُنَا بِرُوحٍ مِنكَ يَا أَرحَمَ الراحِمينْ وَأنْ نَعَمَلَ صَالِحَاً تَرضاهْ وأَدخِلْنَا بِرَحمَتِكَ فِي عِبادِكَ الّصَالِحِينْ محبين سيدنا المصطفى النسب والدين رحمة للعالمين ﷺ رَبَّنَا تَقَبَّلۡ Be-Barkatee wa Be-Izzatee مقام مَحمود صَلَّى اللّٰهُ عَلَيْهِ وَسَلَّمَ waاللهم بعظمتي :سُبْحَانَ رَبِّكَ رَبِّ الْعِزَّةِ عَمَّا يَصِفُونَ - وَسَلَامٌ عَلَى الْمُرْسَلِينَ - وَالْحَمْدُ لِلَّهِ رَبِّ الْعَالَمِينَ لَيۡلَةُ ٱلۡقَدۡرِ خَيۡرٞ مِّنۡ أَلۡفِ شَهۡرٖ شاہ اے مرداں شیر یزداں قوت پروردگار مدد مَوْلَ حيدر امير المؤمنين علي عليه السلام ۔سبحان اللہ ﺁﻣِﻴْﻦُ ﻳَﺎ ﺭَﺏَّ ﺍﻟْﻌَﺎﻟَﻤِﻴْﻦ اللَّهُمَّ صَلِّ عَلَى رُوْحِ مُحَمَّدٍ فِي الْأَرْوَاحِ وَ عَلَى جَسَدِهِ فِي الْأَجْسَادِ وَ عَلَى قَبْرِهِ فِي الْقُبُورِ مدد يا رسول الله ﷴﷺصباح_الخير مدد يا حبيب الله رسول اللہﷺ لَا إِلَهَ إِلَّا اللَّهُ الْعَظِيمُ الْحَلِيمُ، لَا إِلَهَ إِلَّا اللَّهُ رَبُّ الْعَرْشِ الْعَظِيمِ، لَا إِلَهَ إِلَّا اللَّهُ رَبُّ السَّمَوَاتِ، وَرَبُّ الْأَرْضِ، وَرَبُّ الْعَرْشِ الْكَرِيمِ Al-Bayhaqi narrates on the authority of Ibn `Abbas in “Kitab al-Aadaab” (p. 436) & with a second chain Mawquf from Ibn `Abbas in “Shu`ab al-Imaan” & a third from Ibn Mas`ud in “Hayat al-Anbiya’ ba`da Wafatihim” p. 44: “Allah has Angels on the earth – other than the [two] record-keepers – who keep a record [even] of the leaves that fall on the ground. Therefore, if one of you is crippled in a deserted land where NO-ONE is in sight, let him cry out: Ayn-Eebâad-Allâh Raheemakum-Allâh, ‘Help me, O Worshippers of Allah, May Allah have mercy on you!’ Verily he shall be helped, if God wills. ”(أفيدوني عباد الله يرحمكم الله)": Ibn Hajar said it's chain is fair (Isnaduhu Hasan) in “al-Amali“. حلية الأولياء وطبقات الأصفياء Muhammad Ibnay Wasi' Al-Azdi رحمة الله عليه was a Tabi'ee Islamic scholar of hadith, judge, & soldier of fortune, noted for his asceticism (Zuhd). His statement, 'I never saw anything without seeing Allah جل شانه therein' was much discussed by later Sufees. He fought under Qutaybah Ibn Muslim رَضِيَ ٱللَّٰهُ عَنْهُ (d.715) during the Umayyad conquest of Transoxiana, & later became a judge. There is a story that claims that a Muslim رَضِيَ ٱللَّٰهُ عَنْهُ saw in a dream Malik Bin Deenar رحمة الله عليه & Ibn Wasi رحمة الله عليه being led into Jannah, & noticed that Malik رحمة الله عليه was more honoured & allowed to enter first. When he enquired, noting that he believed Ibn Wasi رحمة الله عليه was the more noble, he was told that it was true, "but Mohammed ibn Wasi رحمة الله عليه possessed two shirts, & Malik رحمة الله عليه only one. That is the reason why Malik عَلَيْهِ ٱلصَّلَاةُ وَٱلسَّلَامُ is preferred". Imam Muhammad bin Wasi رحمة الله عليه would often make a supplication which جل شانه الله inspired him to compose. شَّيْطٰانِ الرَّجِيْمِ came to him & said: “Every time I try to approach you I find a barrier in my way. What is the supplication that you make?” “I say: يا الله You have given an enemy power over us who sees our faults & who is aware of our weaknesses. He & his tribe see us from whence we see them not. يا الله (جل شانه), make him give up hope of harming us, just as You have made him give up hope of receiving Your mercy; make him despair of harming us just as You have made him despair of receiving Your pardon. Distance him from us just as You have distanced him from Paradise.” إن شاء الله اللَّهُمَّ إنَّكَ سَلَّطْتَ عَلَيْنَا عَدُوًّا بَصِيرًا بِعُيُوبِنَا، مُطَّلِعًا عَلَى عَوْرَاتِنَا، يَرَانَا هُوَ وَقَبِيلُهُ مِنْ حَيثُ لا نَرَاهُم ، اللَّهُمَّ فَآيِسْهُ مِنَّا كَمَا آيَسْتَهُ مِنْ رَحْمَتِك ، وَقَنِّطْهُ مِنَّا كَمَا قَنَّطْتَهُ مِنْ عَفْوِكَ ، وَبَاعِدْ بَينَنَا وَبَينَهُ كَمَا بَاعَدْتَ بَينَهُ وَ بَيْنَ جَنَّتِك. Allahumma innaka sallat 'alaynaa 'aduwwan baseeran bi-'uyuw-binaa. mutta-li'aan 'ala 'duwra-tinaa. yarana huwa wa qabeeluhu min haytu la nara-hum. Allahumma fa-aa-yees-hu minnaa kama aa-yas-tahu min rahmatika. Wa qannit-hu minnaa kamaa qannit-tahu min 'afwik. wa baa'id bay-nanaa wa bay-nahu kamaa baa'ad-ta bay-nahu wa bay-na jannatik. شَّيْطٰانِ الرَّجِيْمِ said to him:“I promise to never approach you again if you promise not to teach anyone this prayer.” Muhammad bin Wasi رحمة الله عليه responded: "No, Ya Enemy of Allah جل شانه! I will teach it to as many people as I can!"This Amazing Dua, Blocks شَّيْطٰانِ الرَّجِيْمِ Shaytan the Accursed,إن شاء الله" Abu Hurayra رضي الله عنه‎ reported: The Angel (ملاك) عَلَيْهِ ٱلسَّلَامُ جبريل was with حذرت Nubee صلى الله عليه وآله وسلم, & he looked towards the sky, when an Angel (ملاك), known as حذرت Israfeel عَلَيْهِ ٱلسَّلَامُ إِسْـرَافِـيْـل descended. جبريل عَلَيْهِ ٱلسَّلَامُ said, “Verily, عَلَيْهِ ٱلسَّلَامُ إِسْـرَافِـيْـل hasn't come down since the day he was created.” The Angel (ملاك) came to RasoolAllah (ﷺ) & said, Ya RasoolAllah عز و جل, I’m a messenger that’s been sent to you from Allah عز و جل. I’m here to give you a choice, to become either a Nubee (ﷺ) who lives like a King, or a Nubee (ﷺ) that lives like a Humble slave. تبارك الله في كرم النبي صلى الله عليه وسلم who said, "Wealth isn't in having many possessions, but rather (true) wealth is feeling sufficiency in the soul." Our صلى الله عليه وآله وسلم نابي choose to live like a Humble slave. حذرت Israfeel عليه السلامthen said if you had chosen to live like a King, he would have turned the mountains into Gold. حذرت Nubee صَلَّى ٱللَّٰهُ عَلَيْهِ وَآلِهِ وَسَلَّمَ looked towards عَلَيْهِ ٱلصَّلَاةُ وَٱلسَّلَامُ جبرائيل as if he was seeking his advice. So عَلَيْهِ ٱلصَّلَاةُ وَٱلسَّلَامُ جبرائيل indicated that he should be HUMBLE. So Allah's Messenger صَلَّى ٱللَّٰهُ عَلَيْهِ وَآلِهِ وَسَلَّمَ said: "A Prophet-Slave." Az-Zuhri said: So it is said that from that day onwards, the Prophet صَلَّى ٱللَّٰهُ عَلَيْهِ وَآلِهِ وَسَلَّمَ never ate whilst reclining, until he departed from this world. It's related in the Musnad, or in the Sunan of At-Tirmidhi, from Abu Hurayrah رَضِيَ ٱللَّٰهُ عَنْهُ, from the Prophet صَلَّى ٱللَّٰهُ عَلَيْهِ وَآلِهِ وَسَلَّمَ who said:"يا رب- the Mighty & Majestic - gave me the choice that the valley of Makkah be filled with Gold, but I said: No!, يا رب. However, grant food to me one day, & hunger the next day. So when I'm hungry I humble myself before You & remember You, & when I'm full, I'm grateful to You." ﷽ - الصــلوة والسلام‎ عليك‎ ‎يارسول‎ الله ﷺ RasoolAllah ﷺ said, "If I had Gold equal to the mountain of Uhud, it wouldn't please me that anything of it should remain with me after3 nights (i.e., I would spend all of it in Allah's Cause) except what I would keep for repaying debts. Sahih Muslim-Book 24, Number 5129: Mu'awiya bin Suwaid reported: I visited al-Bara' bin 'Azib & heard him say: RasoolAllah صلى الله عليه وآله وسلم commanded us to do 7 things & forbade us to do 7 (things). He commanded us to visit the sick, to follow the funeral procession, to answer the sneezer, to fulfill the vow, to help the poor, to accept the invitation & to greet muslims. forbidding us to wear gold rings, to drink in silver vessels, to use the saddle cloth made of red silk, & to wear garments made of Qassi material, or garments made of silk, brocade & velvet. Narrated Asma bint Umays رَضِيَ ٱللَّٰهُ عَنْهَا RasoolAllah (ﷺ) said to me: May I not teach you phrases which you utter in distress? (These are:) "Allah , Allah is my Lord, I do not associate anything as a partner with Him." حَدَّثَنَا مُسَدَّدٌ، حَدَّثَنَا عَبْدُ اللَّهِ بْنُ دَاوُدَ، عَنْ عَبْدِ الْعَزِيزِ بْنِ عُمَرَ، عَنْ هِلاَلٍ، عَنْ عُمَرَ بْنِ عَبْدِ الْعَزِيزِ، عَنِ ابْنِ جَعْفَرٍ، عَنْ أَسْمَاءَ بِنْتِ عُمَيْسٍ، قَالَتْ قَالَ لِي رَسُولُ اللَّهِ صلى الله عليه وسلم ‏ "‏ أَلاَ أُعَلِّمُكِ كَلِمَاتٍ تَقُولِينَهُنَّ عِنْدَ الْكَرْبِ أَوْ فِي الْكَرْبِ اللَّهُ اللَّهُ رَبِّي لاَ أُشْرِكُ بِهِ شَيْئًا ‏"‏ ‏.‏ قَالَ أَبُو دَاوُدَ هَذَا هِلاَلٌ مَوْلَى عُمَرَ بْنِ عَبْدِ الْعَزِيزِ وَابْنُ جَعْفَرٍ هُوَ عَبْدُ اللَّهِ بْنُ جَعْفَرٍ ‏.‏ Sunan Abi Dawud 1525 ‏ اللَّهُ اللَّهُ رَبِّي لاَ أُشْرِكُ بِهِ شَيْئًا اللّهُـمَّ عافِـني في بَدَنـي ، اللّهُـمَّ عافِـني في سَمْـعي ، اللّهُـمَّ عافِـني في بَصَـري ، لا إلهَ إلاّ أَنْـتَ. اللّهُـمَّ إِنّـي أَعـوذُبِكَ مِنَ الْكُـفر ، وَالفَـقْر ، وَأَعـوذُبِكَ مِنْ عَذابِ القَـبْر ، لا إلهَ إلاّ أَنْـتَ اَللّٰهُمَّ اجْعَلْ أَوْسَعَ رِزْقِكَ عَلَيَّ عِنْدَ كِبَرِ سِنِّيْ وَ انْقِطَاعِ عُمُرِيْ اللهم امين يارب العالمين وصل اللهم وسلم وبارك على سيدنا ونبينا محمد وعلى آله وصحبه وسلم تسليما كثيرا طيبا مباركا فيه يارب العالمين Accorging to Shaykh Abu Bakr Bin Hawaaraa al-Bataa-ihee RahmuthAllah Alay who lived before the time of al-Ghawth al-Adham (ra) & was amongst the distinguished Masha-ikh of Baghdad. Once, while he was sitting in his majlis, he said:There are seven Aqtaab (High-Ranking Awliya) of Iraq: Sheikh Maroof Al-Karki (ra) Sheikh Imam Ahmad bin Hanbal (ra) Sheikh Bishr Haafi (ra) Sheikh Mansoor bin Amaar (ra) Sayyiduna Junaid al-Baghdadi (ra) Sheikh Sahl bin Abdullah Tastari (ra) Sheikh Abdul Qadir Al-Gaylaani (ra) When he heard this, Sayyidi Abu Muhammad (ra), who was a mureed of Sheikh Abu Bakr (ra) asked him, We have heard & we know six of these names, but the seventh, we have not heard of. O Shaykh! Who is Abdul Qadir Al-Gaylani? Shaykh Abu Bakr (ra) replied by saying:"Abdul Qadir (ra) will be a non-Arab (& a) pious man. He will be born towards the end of the fifth century Hijri & reside in Baghdad"; According to: (Bahjatul Asraar) Madutt Ya Rasul Allah Sallallahu Alayhi Wasallam Madutt Ya Ghowth Al-Aadham Dastageer Quranic Verse About The Awliya Of Allah: Ah! Indeed, the friends of Allah there is no concern for them, & they don't grieve. The friends of Allah are those who believe with caution.(Yunus 10: 62-63)

Nasheeds

Fountains of Sacred Knowledge

I strongly Disagree with a Da-eef Hadeeth found in the Sunni Sharia - book: Reliance of the Traveller:
A translation of the classical manual of Islamic Sacred Law (Shari'ah) `Umdat as-Salik by Ahmad ibn Naqib al-Misri (d. 769/1386), in Arabic with facing English text, commentary and appendices edited and translated by
Nuh Ha Mim Keller. "That States: An Arab Shall NOT Marry a Non-Arab", because Imam Hussain(as)'s wife My Grandmother Shahrbanu SalaamALLAH Alayha was a Non-Arab, and the eldest daughter of Yazdegerd III, the last emperor of the Sassanid dynasty of Persia.
In the period of the second Sunni caliph Umar Radee-Allahu Anhu, the muslims conqured Iran. The daughters of Yazdegerd III were made captives, and Umar Radee-Allahu Anhu wanted to sell them, but Hadruth Ali KarmAllahu Wajhu (the first Ithna-Asharee Imam) stopped him from doing so and said
to Umar Radee-Allahu Anhu, "leave the girls free so that they marry whomsoever they wish".
Shahrbanu Radee-Allahu Anha chose Imam Hussain alaih Salaam and her sister chose Muhammad ibn Abu Bakr Radee-Allahu Anhu.  Hadruth Ali KarmAllahu Wajho said to Imam Hussain alaih Salaam
"Look after this woman well, because, from her an Imam will come into existence who will be the
best of Allah's creations upon the earth and the father of all the Imams (after himself) ".
After marrying Hussain ibn Ali KarmAllahu Wajhu, Shahrbanu alay Salaam  gave birth to a son,  Imam Zain al-Abideen Zeenathay Sajideen Ali ibnay Hussyn (As-Sajjad a.s.), Alay Salaatu Wa Salaam
the fourth Shi'ah Imam. Soon after giving birth Shahrbanu alay Salaam, died. Today there is a shrine to Shahrbanu aly Salaam at Rayy, in the southern suburbs of Tehran, Iran. I'm pretty sure Imam Husayn aly Salaatu wa Salaam has been to Iran many times, due to the calls of 100's of pilgrims who call out "Labay Ya Husayn".
Imam Huayn had 3 other wives. Umme Rubab, who was the mother of Ali Asghar & Bibi Sakina (Ruqayya).
Umme Layla bint Abi Murrah al-Thaqafi, who was the mother of Ali Akbar. Also Ishaq bint Talhah, who is said
to have married Imam Hasan ibn Ali Aly Salaam, & had a son named Talha ibn Hasan Radee-Allahu Anhu. After Imam Hasan aly Salaam passed away, she married
Imam Husayn alay Salaam, and had a daughter Fatemah bintay Husayn Radee-Allahu Anha.
Please let me know if there are any errors, Inshallah.

ALLAH has cursed the Cartoon-maker, therefore I suggest  Movie stars teach Arabic language to Hindi and English Speakers, in a similar fashion as the Sinbad Cartoons which may be good for kids, but not appropriate with the Sharia of islam, rather than dancing like the KAFIR which is strictly forbidden by the Shariah of Islam, or if you're rich you can also learn from: http://www.eaalim.com/arabic-quran/why-ealim.aspx

 inSHALLAH

 



Arabic term or phrase:A'udzu-billahis-Sameul-Aleemee-minash shaytaan-nirajeem minhumzee-hee wa Nafqee-hee wa Nafthee-hee
English translation:I seek refuge in Allah from the hearing and knowing of Satan the outcast, along with his direct, indirect temptations, music & his madness. Allahumma inni as aluka al Afiyah fid-Dunya wal-Akhirah. Allahumma inni as aluka al-‘Afwa wal-‘Afiyah fid-Deenee wa Dunya, wa Ahli wa Mali. Allahumma ustur ‘Awrati, wa min raw’ati. Allahumma Ah-fiz-nee min bayni Yadayya wa min Khalfi, wa ‘an Yamini wa ‘an Sheemali wa min Fawqi, wa ‘auoodu bi’Azamatika an ughtala min tah-tee. Ya الله سبحانه وتعالى الله جل جلاله مَدَد (The Almighty...- Protect me, & Guide me), I Beg You for Security in this World & in the Hereafter: Ya الله سبحانه وتعالى الله جل جلاله, I ask You for forgiveness & security in my religion & my worldly affairs, in my family & my property; Ya الله سبحانه وتعالى! Conceal all my mistakes & keep me safe from the things which I fear; Ya الله سبحانه وتعالى الله جل جلاله, Guard me in front of me & behind me, on my right hand & on my left, & from above me & I seek Refuge in Your Greatness from receiving unexpected harm from below me.للهم صلِّ على سيدنا محمد وعلى آل سيدنا محمد الذي اختاره الله في الدنيا رسولاً وفي الآخرة شفيعاً فقال جل من قائل : { قل يا أيها الناس إني رسول الله إليكم جميعاً الصلوۃ والسلام علیک یا رسول اللہ سـيـدنـا مـحـمـد زيناتاي أرشيكا و شريف نساء مصطفى أَزْوَاجٌ مُّطَهَّرَ أمهات المؤمنين و ذريته المباركه أخوه من الأنبياء والمرسلين إكراميكا والملائكة القديسون و آلک و اصحابک یا حبیب اللہ صلی اللہ علیہ وآلہ وسلم اللهم ارحمني يا ارحم الراحمين يا أرحم الراحمين فرج على المسلمين رَبَّنَا أَنزِلْ عَلَيْنَا مَآئِدَةً مِّنَ السَّمَاء تَكُونُ لَنَا عِيداً لِّأَوَّلِنَا وَآخِرِنَا وَآيَةً مِّنكَ وَارْزُقْنَا وَأَنتَ خَيْرُ الرَّازِقِينَ اللَّهُ لَطِيفٌ بِعِبَادِهِ يَرْزُقُ مَن يَشَاءُ ۖ وَهُوَ الْقَوِيُّ الْعَزِيزُ اللَّهُمَّ إَنِّي أَسْأَلُكَ مِنْ فَضْلِكَ اُسْكُنْ بِالذِيْ يَسْكُنْ لهُ مَا فِي السَّمَاوَاتِ وَالأرْض وَهُوَ السَّمِيْعُ العَلِيْمُ أ’عضو بالله و قدراته من شارع ما أجيد و أحذرو يَا حَيُّ يَا قَيُّوْمُ بِرَحْمَتِكَ أَسْتَغِيْث “Calm down by [the name of] that being for whom everything in the heavens & the earth calms down & He is the All-Hearing, All-Knowing.” Uthman b. Abu al-‘As Al-Thaqafi reported that he made a complaint of pain to Allah’s Messenger (ﷺ) that he felt in his body at the time he had become a Muslim. Thereupon Allah’s Messenger (ﷺ) said:Place your hand at the place where you feel pain in your body & say Bismillah (in the name of Allah) 3 times & 7 times A’udhu billahi wa Qudratihi min Sharri ma Ajeedu wa UhadhaaRuu (I seek refuge with Allah & with His Power from the evil that I find & that I fear). ; االلهم آمين يارب العالمين والصلاة والسلام على أشرف الخلق و المرسلين سيدنا وحبيبنا محمد وعلى آله وصحبه وسلم تسليما كثيرا طيبا مباركا فيه كما ينبغي لجلال وجهك وعظيم سلطانك الخطبة الثانية: الحمد لله ونستعينه ونستغفره. ونحن نؤمن به ونضع ثقتنا فيه. نعوذ بالله من شرور أنفسنا ومن سيئات أعمالنا. من يهده الله فلا مضل له، ومن يضلل فلا هادي له. ونشهد أن لا إله إلا الله وحده لا شريك له. ونشهد أن محمدا عبده ورسوله (سنن ابن ماجه 1893). إن الله يصلي على النبي وملائكته. يا أيها الذين آمنوا صلوا عليه وسلموا تسليما (القرآن 33:56). يا الله! وصلى وسلم على محمد وآل محمد بعدد المصلين والصائمين. يا الله! وصلى الله على محمد وآله بعدد القاعد والقائم. وعلى جميع الأنبياء والمرسلين والملائكة الكرام (الصلاة والسلام). وعلى العباد الصالحين برحمتك يا أرحم الراحمين! يا عباد الله! إن الله يأمر بالعدل والإحسان وإيتاء ذي القربى وينهى عن الفحشاء والمنكر والبغي. يعظكم لعلكم تذكرون (القرآن 16:90). وذكر الله أكبر وأعظم من كل شيء اللهم لك الحمد والشكر على ما أنعمت به علينا اَللّٰهُمَّ إِنِّيْ أَسْأَلُكَ بِأَنِّيْ أَشْهَدُ أَنَّكَ أَنْتَ اللّٰهُ لَا إِلٰهَ إِلَّا أَنْتَ ، الْأَحَدُ الصَّمَدُ الَّذِيْ لَمْ يَلِدْ وَلَمْ يُوْلَدْ ، وَلَمْ يَكُنْ لَّهُ كُفُوًا أَحَدٌ الحمد لله رب العالمين والصلاة والسلام على أشرف الأنبياء والمرسلين سَيِّدِناَ وَمَوْلاَناَ نبينا محمد وإخوانه من الأنبياء والمرسلين وعلى آله وأزواجه وصحبه وا ذرية اجمعین دائما وابدا كثيرة وَأَقِمِ ٱلصَّلَوٰةَۖ إِنَّ ٱلصَّلَوٰةَ تَنۡهَىٰ عَنِ ٱلۡفَحۡشَآءِ وَٱلۡمُنكَرِۗ وَلَذِكۡرُ ٱللَّهِ أَكۡبَرُۗ وَٱللَّهُ يَعۡلَمُ مَا تَصۡنَعُونَ صلاة الكنز الاعظم اللهم اجعل افضل صلواتك ابدا وانمي بركاتك سرمدا وازكي تحياتك فضلا وعددا علي اشرف الخلائق الانسية والجانية ومجمع الحقائق الايمانية ومظهر التجليات الاحسانية ومهبط الاسرار الرحمانية واسطة عقد النبيئين ومقدم جيش المرسلين وقائد ركب الانبياء المكرمين وافضل الخلق اجمعين حامل لواء العز الاعلي ومالك ازمة المجد الاسني شاهد اسرار الازل ومشاهد انوار السوابق الاول وترجمان لسان القدم ومنبع العلم والحلم والكرم مظهر سر الجود الجزئي والكلي وانسان عين الوجود العلوي والسفلي روح جسد الكونين وعين حياة الدارين المتحقق باعلي رتب العبودية والمتخلق باخلاق المقامات الاصطفائية الخليل الاعظم والحبيب الاكرم سيدنا محمد بن عبد الله بن عبد المطلب وعلي ىله وصحبه عدد مخلوقاتك ومداد كلماتك كلما ذكرك الذاكرون وغفل عن ذكرك الغافلون وسلم تسليما كثيرا ورضي الله عن اصحاب رسول الله اجمعين صلاة الكنز الأعظم والقطب المعظم للباز عبدالقادر الجيلاني قدس الله سره: بسم الله الرحمن الرحيم اللهم اجعل أفضل صلواتك أبدا وأنمى بركاتك سرمدا وأزكى تحياتك فضلا وعددا على أشرف الخلائق الإنسانية ومجمع الحقائق الإيمانية وطور التجليات الإحسانية ومهبط الأسرار الروحانية وعروس المملكة الربانية واسطة عقد النبيين ومقدم جيش المرسلين وقائد ركب الأنبياء المكرمين وأفضل الخلق أجمعين حامل لواء العز الأعلى ومالك أزمة المجد الأسنى شاهد أسرار الأزل ومشاهد أنوار السوابق الأول وترجمان لسان القدم ومنبع العلم والحلم والحكم ومظهر وجود الكلى والجزئى وإنسان عين الوجود العلوى والسفلى روح جسد الكونين وعين حياة الدارين المتحقق بأعلى رتب العبودية المتخلق بأخلاق المقامات الإصطفائية الخليل الأكرم والحبيب الأعظم سيدنا محمد بن عبدالله ابن عبدالمطلب خاتم النبيين وعلى آله وصحبه وسلم أجمعين عدد معلوماتك ومداد كلماتك كلما ذكرك الذاكرون وغفل عن ذكرك الغافلون وسلم كثيرا إلى يوم الدين صلاة الكبريت الأحمر للإمام الهمام عبد القادر الجيلاني رضي الله عنه بسم الله الرحمن الرحيم اللهم اجعل أفضل صلواتِك أبداً ، وأنمى بركاتك سرمداً ، وأزكى تحياتك فضلاً وعدداً ، على أشرف الخلائق الإنسانية ، ومعدن الدقائق الإيمانية ، وطور التجليات الإحسانية ، ومهبط الأسرار الرحمانية ، وعروس المملكة الربانية ، واسطة عقد النبيين ، ومُقَدِّم جيش المرسلين ، وأفضل الخلائق أجمعين ، حامل لواء العز الأعلى ، ومالك أزمَّةِ الشَّرفِ الأسنى ، شاهد أسرار الأزل ومشاهد أنوار السوابق الأول ، وترجمان لسان القدم ، ومنبع العلم والحلم والحكم ، مظهر سر الوجود الجزئي والكلي ، وإنسان عين الوجود العلوي والسفلي ، روح جسد الكونين ، وعين حياة الدارين ، المتخلق بأعلى رتب العبودية المتحقق بأسرار المقامات الإصطفائية ، سيد الأشراف وجامع الأوصاف ، الخليل الأعظم ، والحبيب الأكرم ، المخصوص بأعلى المراتب والمقامات المؤيد بأوضح البراهين والدلالات ، المنصور بالرعب والمعجزات الجوهر الشريف الأبدي والنور القديم السرمدي سيدنا ونبينا محمد المحمود في الإيجاد والوجود ، الفاتح لكل شاهد ومشهود حضرة المشاهدة والشهود ، نور كل شيء وهداه سر كل سر وسناه الذي انشقت منه الأسرار وانفلقت منه الأنوار ، السر الباطن ، والنور الظاهر السيد الكامل الفاتح الخاتم ، الأول الأخير الباطن الظاهر العاقب الحاشر ، الناهي الآمر الناصح الصابر الشاكر القانت الذاكر الماحي الماجد الغزيز الحامد المؤمن العابد المتوكل الزاهد القائم الشهيد الولي الحميد البرهان الحُجةُ المطاع المختار الخاضع الخاشع البر المستنصر الحق المبين طه ويس المزمل المدثر سيد المرسلين وإمام المتقين وخاتم النبيين وحبيب رب العالمين المصطفى والرسول المجتبى الحكم العدل الحكيم العليم العزيز الرؤوف الرحيم نورك القديم وصراطك المستقيم ، صلى الله عليه وسلم محمد عبدك ورسولك وصفيك وخليلك ودليلك ونجيك ونخبتك وذخيرتك وخيرتك ، وإمام الخير وقائد الخير رسول الرحمة النبي الأمي العربي القرشي الهاشمي . الأبطحي المكي المدني التهامي المشاهد المشهود الولي المقرَّب السعيد المسعود الحبيب الشفيع الحسيب الرفيع المليح البديع الوعظ البشير النذير العطوف الحليم الجواد الكريم الطيب المبارك المكين الصادق المصدوق الأمين ، الدعي إليك بإذنك ، السراج المنير الذي أدرك الحقائق بحجتها ، وباز الخلائق برُمتها وجعلته حبيباً وناجيته قريباً وأدنيته رقيباً ، وختمت به الرسالة والدلالة والبشارة والنَّذارة والنبوة ، ونصرته بالرعب وظللته بالسحب ورددت له الشمس وشققت له القمر وأنطقت له الضب والظبي والذئب والجذع والذراع والجمل والجبل والمدر والشجر ، وانبعث من أصابعه الماء الزلال وأنزلت من المزن بدعوته في عام الجدب والمحل وابل الغيث والمطر ، فاعشوشبت منه القفر والصخر والوعر والسهل والرمل والحجر ، واسريت به ليلا من المسجد الحرام إلى المسجد الأقصى إلى السموات العلى إلى سدرة المنتهى إلى قاب قوسين أو أدنى ، وأريته الآية الكبرى وأنلته الغاية القصوى وأكرمته بالمخاطبة والمراقبة والمشافهة والمشاهدة والمعاينة بالبصر ، وخصصته بالوسيلة العذراء والشفاعة الكبرى يوم الفزع الأكبر في المحشر ، وجمعت له جوامع الكلم وجواهر الحِكم ، وجعلت أمته خير الأمم وغفرت له ما تقدم من ذنبه وما تأخر ، الذي بلع الرسالة وأدى الأمانة ونصح الأمة وكشف الغُمة وجلى الظُلمة وجاهد في سبيل الله وعبد ربه حتى أتاه اليقين . اللهم ابعثه مقاماً محموداً يغبطه فيه الأولون والآخرون . اللهم عَظِّمهُ في الدنيا بإعلاء ذكره وإظهار دينه وإبقاء شريعته ، وفي الآخرة بشفاعته في أمته وأجزل أجره ومثوبته وأيد فضله على الأولين والآخرين ، وتقديمه على كافة المقربين الشهود. اللهم تقبل شفاعته الكبرى وارفع درجاته العليا وأعطه سُئله في الآخرة والأولى كما أعطيت ابراهيم وموسى . اللهم اجعله من أكرم عبادك عليك شرفاً ومن أرفعهم عندك درجةً وأعظمهم خطراً وأمكنهم شفاعةً . الله عظِّم برهانه وأبلج حجته وأبلغ مأموله في أهل بيته وذريته . اللهم أتبعه من ذريته وأمته ما تقر به عينه واجزه عنا خير ما جازيت به نبياً عن أمَّتِه وأجز الأنبياء كلهم خيراً . الله صل وسلم على سيدنا محمد عدد ما شاهدته الأبصار وسمعته الآذان ، وصل وسلم عليه عدد من لم يصل عليه ، وصل وسلم عليه كما تحب وترضى أن يصلى عليه ، وصل وسلم عليه كما أمرتنا أن نصلي عليه ، وصل وسلم عليه كما ينبغي أن يصلى عليه . اللهم صل وسلم عليه وعلى آله عدد نعماء الله وإفضاله . اللهم صل وسلم عليه وعلى آله وأصحابه وأولاده وأزواجه وذريته وأهل بيته وعشيرته وعترته وأصهاره وأحبابه وأتباعه وأشياعه وأنصاره خزنة أسراره ومعادن انواره وكنوز الحقائق وهداة الخلائق نجوم الهدى لمن اقتدى ، وسلم تسليماً كثيراً دائماً أبداً وارضى عن كل الصحابة رضاً سرمداً عدد خلقك وزنة عرشك ورضاء نفسك ومداد كلماتك كلما ذكرك وسهى عن ذكرك الغافلون ، صلاةً تكون لك رضاءً وبحقه أداءً ولنا صلاحاً ، وآته الوسيلة والفضيلة والدرجة العالية الرفيعة وابعثه المقام المحمود ، وأعطه الدواء المعقود والحوض المورود ، وصل يارب على جميع إخوانه من النبيين والمرسلين وعلى جميع الأولياء والصالحين صلوات الله عليهم أجمعين ، اللهم صل على سيدنا محمد السابق للخلق نوره الرحمة للعالمين ظهوره عدد من مضى من خلقك ومن بقي ومن سعد منهم ومن شقي ، صلاة تستغرق العد وتحيط بالحد ، صلاة لا غاية لها ولا انتهاء ولا أمد لها ولا انقضاء ، صلاة دائمة بدوامك وباقية ببقائك لا منتهى لها دون علمك ، صلاة ترضيك وترضيه وترضى بها عنا ، صلاةً تملأ الأرض والسماء صلاةً تتحل بها العقد وتفرج بها الكرب وتجري بها لطفك في أمري وأمور المسلمين ، وبارك على الدوام وعافنا واهدنا واجعلنا آمنين ، ويسر أمورنا مع الراحة لقلوبنا وأبداننا والسلامة والعافية في ديننا ودنيانا وآخرتنا ، وتوفنا على الكتاب والسنة ، واجمعنا معه في الجنة من غير عذاب يسبق وأنت راضٍ عنا ولا تمكر بنا واختم لنا بخير منك وعافية بلا محنة أجمعين ، سُبْحَانَ رَبِّكَ رَبِّ الْعِزَّةِ عَمَّا يَصِفُونَ وَسَلامٌ عَلَى الْمُرْسَلِينَ وَالْحَمْدُ لِلَّهِ رَبِّ الْعَالَمِينَ. الحمد لله وكفىٰ، والصلاة والسلام على إمام الأنبياء سيدنا ومولانا محمد صلى الله عليه وسلم وعلى آله وذريته خاصة حضرة محيي الدين الامامي عبد القادر الجيلاني عليه الصلاة والسلام May Allah Bless us by The Prayer of the کبریت احمر (Red Sulphur) Just as the legendary Red Sulphur was believed by alchemists to turn base metal into pure gold, this salutation transforms the base & diseased heart into one of spiritual abundance, إن شاء الله
وْذُ بِاللهِ مِنَ الشَّيْطَانِ الرَّجِيْمِ
I seek refuge in Allah from the Evil Shaytan
.
 
The Friends of ALLAH don't Grieve!!!https://www.youtube.com/watch?v=pnGjlivY3a0
 
I hope, Ariana Grande, Marie Taylor Hill, Navya Naveli, Mouni Roy & all other Movie Stars & beauties I have in mind, will become true practicing muslims. WISHING as I'm wishing, thinking as I'm thinking & whispering Duas for their safety against the Evils of Shaytaan, the Messiah Dajjal, & his Wicked gang of Black Magicians.  I sincerely hope you and them are also making Duas for me, MERA Dilco Do-wa Dee-jee-yaa! Ameen!
 
Love and Obey ALLAH above all
from yours True-Ali,
Sayideena Safe-udeen
a servant of  ALLAH-Malikee-Yaumideen!!!
 

 
It's shocking. Hilton, one of the most renowned hotel chains in the world, could be complicit in child sexual exploitation, in their own facilities!

Hotels are one of the primary places where slave children are sold for sex by brutal pimps. And Hilton has not even signed up to a basic international Code of Conduct that forces hotels to train their staff to detect, report and assist girls and women forced into the sex industry. Hilton's action on this would be huge -- if they signed up to The Code, it would create a network of Hilton employees in 77 countries and 32,000 hotels working against the rape trade of women and children.

There is no time to lose in stopping this terrifying trade. Sign the petition for Hilton to implement The Code of Conduct for the Protection of Children From Sexual Exploitation in Travel and Tourism. When we hit 250,000 signatures, we'll take out ads in major newspapers in McLean, Virginia - the city where Hilton CEO Chris Nassetta lives and works:

http://www.avaaz.org/en/hilton_sign_now/?vl

The ECPAT Code of Conduct for the Protection of Children from Sexual Exploitation in Travel and Tourism gets hotels to train their staff to recognize victims of the rape trade and underage prostitution, educate their guests about the dangers of sex tourism, liaise with local law enforcement and advocate for victim rights. It works by creating a first line of defense against sex trafficking around the world. To date, The Code affects 30 million tourists a year - vastly increasing the chances of arresting those trafficking girls and helping those trapped in the trade.

After brothels were found in Hilton hotels in Ireland and China, thousands sent letters to the hotel chain in protest, and Hilton acknowledged its need to address the problem of child prostitution. But to date no concrete steps have been taken. By shaming Hilton CEO Nasetta in his own home town with a slew of newspaper ads and calling on him to implement The Code, we could force him and his employees to protect children in the most effective way, worldwide.

At some point in our lives many of us will visit a hotel - which of us would feel comfortable staying in a room where, close by, underage girls are being sold to men and forced to have sex? Sexual tourism that exploits women and girls benefits from hotel staff who look the other way or get a pay off to turn a blind eye. We need hotels to have a zero tolerance policy towards child sexual exploitation in their facilities.

To date, more than 900 companies across the world, including the Radisson and Country Inn Suites hotel, have signed The Code. Hilton is under pressure to join them. Click below to urge Hilton to join in the fight against sex trafficking:

http://www.avaaz.org/en/hilton_sign_now/?vl

Every day, hundreds of girls around the world are forced into sexual slavery. Our global call for accountability and training in the world’s largest hotel chain can make a huge dent in this vile trade.

With hope,

Alice, Emma, Graziela, Ricken and the rest of the Avaaz team

Sources:

Tell Hilton Hotels to Prevent Child Prostitution in Their Hotels:
http://www.change.org/petitions/view/tell_hilton_to_prevent_child_prostitution_in_their_hotels

Hilton hotel closed by Chinese police over prostitution charges:
http://www.telegraph.co.uk/finance/china-business/7844335/Hilton-hotel-closed-by-Chinese-police-over-prostitution-charges.html/

Women arrested in Hilton 'brothel':
http://www.herald.ie/national-news/women-arrested-in-hilton-brothel-1435317.html

War on child prostitution targets hotels:
http://www.nation.co.ke/News/regional/War%20on%20child%20prostitution%20targets%20hotels%20%20/-/1070/965158/-/ndfubvz/-/index.html

Hotelier acts on child prostitution:
http://news.bbc.co.uk/2/hi/asia-pacific/2780957.stm

New ways to prevent child prostitution:
http://www.ajc.com/opinion/new-ways-to-prevent-524077.html

Support the Avaaz community! We're entirely funded by donations and receive no money from governments or corporations. Our dedicated team ensures even the smallest contributions go a long way --
donate here

Frank Medrano - SUPERHUMAN LEBERT EQUALIZER Training  

https://www.youtube.com/watch?v=YOOJ0rB5Vw4

Beginning Fitness for Military and Police 

by Stew Smith CSCS, former Navy SEAL and fitness author.

http://www.stewsmith.com/linkpages/milbeginnerfitness.htm

 https://www.youtube.com/watch?v=YXTw4cx9oMc

http://beverlyhills-md.com/dark-spot-corrector/video_gcana.php?gclid=CIrD0fO83sgCFQYIaQoduKEEng

http://www.mensfitness.com/nutrition/what-to-eat/all-meat-vs-vegetarian-diets


The Ratio of Your Shoulders to your Waist, is known as the Adonis Golden Ratio.

Wladimir-Klitschko's exercises SMARTLY, so should we, in Sha ALLAH

If you want to have Wladamir type abs, than avoid 5 foods- 1.Processed Foods, 2.Cheese 3.Soy Based Foods 4.Commercial Milks. 5.Yogurts

The Friends of ALLAH don't Grieve!!!

Kabhi Palkow PayAsso Hai

medinainbeautifullpurlple.jpg

iaddedthecolorstothisgravestone.jpg

وْذُ بِاللهِ مِنَ الشَّيْطَانِ الرَّجِيْمِ
I seek refuge in Allah from the Evil Shaytan.

If you want to perfom Hajj, keep your self fit!!!
ihopesomeonewillputpeacockfeathersonmygravewhenipassawayinshallah.jpg
http://www.ultimatebodypress.com/ultimate-body-press-dip-bar.html

HUM BE-WAWAFA HURGIS NUTHAY
judgmentday.jpg
https://www.youtube.com/watch?v=bGwu-38xg34

luxor.jpg

Welcome to the site that shall lead us to the SUNNAH of Marriage, inSHA-ALLAH

If any one who loves ALLAH & the Shariah of his Rasool-SallAllahwalay- hee Aleehi wa Aswaajehee wa Salim is interested in getting married:

Please contact the Britisher-Syedah Nazli Ali @:
muslimmarriageforyou@yahoo.co.uk
or if your an interested Single Female, thinking or considering about making Nikkah with me, I humbly request you to sing in your heart these Nasheeds!
 
 
 
Then ask ALLAH if I'm the best for you, & send me your profile@: Sayidina@gmx.us or you can also make Ziayarah of Hadruth-Telli Baba Abdullah Qadree  & show him my picture requesting him to let you know if I'm the best man for you!
 
If you don't want to get married!  and can't afford to be buried!, like Telli Baba in your own private Zawviyya, then I suggest you get your friends &/or relatives to get you buried in a cheap place like that's being offered by DARUL BARZAKH GARDENS,  which is the first & only Exclusive SUNNI burial land, check it out @ http://www.themgcc.com/
 

Majority of Cremations are BAD for our Environment The scattering of ashes is discouraged by all Abrahamic Religions & the Cremation Society itself on mountain tops, where ashes can affect plant life. In rivers, near places where people bathe or fish Less than a kilometre upstream of where water is taken for drinking.If plastic wreaths are thrown into the water or left on river banks. On windy days, ashes affect people living & working nearby. However Rajesh Khanna's mortal remains were encased in a glass coffin, which isn't too BAD. Glass coffins, which were cushioned with yards of fabric, were not meant to display the body but rather to hygienically protect it from the elements. Another benefit of a glass casket is that it's environmentally friendly. Wooden caskets have to be treated with chemicals to prevent them from rotting. Metal caskets use a lot of energy & resources to manufacture. Glass caskets, on the other hand, are made from recycled materials & can be recycled after use. This makes them a much more sustainable option for those who are concerned about environmental issues.

khatamayghawthia.jpg


 

I love all the Silsilas- Check-out all the Sufi tareeqahs, their cool!

If you desire to marry a spiritually beautifull person,

I, Syed Safe-ud-dean Ali, suggest you remove all the filth from your heart, by making Tobah, Dua, & reading Salawat with - Waza-if  of any good Sufi-tareeqah like that of Sidi Ahmed AlTijani NafunAllahubee https://issuu.com/albaz/docs/ya-man-azhar-al-jameel/EM>:

KHATM UL SILSILAH-QADARIA KABEER (alayhim Ridwaan)

 can be found at the following internet link:

http://www.raza.co.za/durood_and_supplications_qaseedah_ghausia.html

 

KHATM UL-KHWAAJGAAN (alayhim Ridwaan)

1

Allahumma salle alaa sayidina

Muhammadiw wa alaa aaley

Sayidina Muhammadim ma’dinil

judy wal karami (Sall-Allahu layka

wa alaa aalika ya Muhammad)

Note: Durood is recited 3-5 times after

every wird until beginning of Surah

La hawla wa la quwwata illa billahil

Aliul Azeem (3-5 times)

Hasbun Allahi wa ni’mal wakeel

(3-5 times)

La ilaha illa Anta subahanaka inni kuntu

min az-zaalimeen (3-5 times)

Ya Baaqi Anta al-Baqi (3-5 times)

Ya Kaafi Anta al-Kafi (3-5 times)

Ya Shaafi Anta ash-Shafi (3-5 times)

Ya Haadi Anta al-Haadi (3-5 times)

Ya Hayyu Ya Qayyumu Thabbitna ala

al-Imaan (3-5 times)

Ya Khafiyy al-Lutfi adrikni bilutfikal-

Khafiyya (3-5 times)

Ya Badiy al-‘Ajaib bil khairry

Ya Badiyu Jalla Jalaalahu (3-5 times)

Fallahu khaira hafizaa - wa Huwa

Arham ur-Rahimeen (3-5 times)

Wa ufawwidu amri illllahi innallaha

Basirum bil ‘Ibaad (3-5 times)

Allahumma inna naj’aluka fi nuhurihim

wa naudhu-bika min shururihim

(3-5 times)

Laqad jaa-akum Rasoolum min unfoosikum

azizun alaihee ma ‘anittum

harisun ‘alaikum bil mumineena rauf ur-

Raheemun fa in tawallau fa qul hasbi-

Allahu la ilaha illa Huwa alaihi

tawakkaltu wa Huwa Rabbul ‘arsh il-

Azeem (3-5 times)

_

SURAHs

Bismillahi ar-Rahmani ar-Rahim

Alam nashrah laka sadrak

Wa wada’ana an-ka wizrak

Alladhi anqada zahrak

Wa rafa’ana laka dhikrak

Fa inna ma’al ‘usri yusraa

Inna ma’al ‘usri yusraa

Fa idha faraghta fa ansab

Wa ila Rabbika farghab

(3-5 times)

Bismillahi ar-Rahmani ar-Rahim

Qul Hu-Allahu Ahad

Allahus Samad

Lam yalid wa lam yulad

Wa lam yakun-lahu kufu-an Ahad

(3-5 times)

Bismillahi ar-Rahmani ar-Raheem

Qul a’udhu bi-Rabb il-falaq

Min sharri ma khalaq

Wa min sharri ghasiqin idha waqab

Wa min sharrin nafathati fil uqad

Wa min sharri hasidin idha hasad

(3-5 times)

Bismillahi ar-Rahmani ar-Raheem

Qul a’udhu bi-Rabb in-naas

Malik in-naas

Ilah in-naas

Min sharril waswaas il-khannas

Alladhi yuwaswisu fi sudur in-naas

Min al-jinnati wan-naas

(3-5 times)

Bismillahi ar-Rahmani ar-Raheeem

Al hamdu Lillahi Rabb il-’aalamin

Ar-Rahman ir-Rahim

Maaliki yawm id-din

Iyyaka na’abudu wa iyyaka nasta’een

Ihdina as-siraat al-mustaqeem

Siraat al-ladhina an’amta ‘alaihim

Ghairil maghdubi ‘alaihim wa la addaalin

(3-5 times)

_

KHATM UL-KHWAAJGAAN (alayhim Ridwaan)

2

Allahumma ya Hull al-Mushkilaat

(3-5 times)

Allahumma ya Kaafi al-Muhimmaat

(3-5 times)

Allahumma ya Qadi ul-Haajaat

(3-5 times)

Allahumma ya Musabbib ul-Asbab

(3-5 times)

Allahumma ya Muffatih al-Abwaab

(3-5 times)

Allahumma ya Rafi ‘ad-Darajaat

(3-5 times)

Allahumma ya Manzil al-Barakaat

(3-5 times)

Allahumma ya Dafi’ al-Baliyyaat

(3-5 times)

Allahumma ya Shaafi’y al-Amraad

(3-5 times)

Allahumma ya Khair an-Naasireen

(3-5 times)

Allahumma ya Mujeeb ud-Da’waat

(3-5 times)

Allahumma ya Sami’y al-Aswaat

(3-5 times)

Allahumma ya Arham ar-Raahimeen

(3-5 times)

Allahumma aameen aameen aameen

(3-5 times)

Ya Hayyu ya Qayyumu bi-haqqi la

ilaaha illa Anta subhanaka inni kuntu

min az-zaalimeen (3-5 times)

Salli wa sallim ya Allahu alaa

Muhammadin sall-Allah (3-5 times)

_

Hasbi Rabbi Jall-Allah

Maa fi Qalbi ghair-Allah

Noor-e-Muhammed sall-Allah

La ilaha ill-Allah Muhammadur Rasulullah

Awwal-o-Aakhir hai Allah

Baatin-o-Zaahir hai Allah

Hafiz-o-Nasir hai Allah La ilaha ill-Allah

Jism may jaan may hai Allah

Kaun-o-makaan may hai Allah

Dono jahan may hai Allah La ilaha ill-

Allah

Hasbi Rabbi jisnay kahaa

Faiz kay darya ko paayaa

Gohr-e-maqsad haat aaya La ilaha ill-

Allah

Khul jain dar Jannat kay

Dozakh ki sub aag bujhay

Dil say jo ik baar kahay La ilaha ill-Allah

Murshad-e-kamil ka hai raaz

Deen-e-Nabi ka hai aijaaz

Ummat-e-Ahmad ka hai naaz

La ilaha ill-Allah Muhammadur Rasulullah

Aarz ghulam-e-faqir hai ab

Dakhil-e-Rehmat ho hum sab

Zikr qabul ho yeh ya Rabb La ilaha ill-

Allah

La m’abuda ill-Allah

La maqsooda ill-Allah

La maujooda ill-Allah La ilaha ill-

Allah

Zaat hai uski laasani

uski sift hai nooraani

Sirr kalaam-e-Ra’bbani La ilaha ill-Allah

Zikr-e-khafi o jalli hai yahee

Raaz asbaat o nafi hai yahee

Zikr paas-e-alfaaz yahie La ilaha ill-Allah

Muhammadur Rasulullah Sall-Allahu Ta’ala

alaihi wa alihee wa sallim

 If words come out of the heart, they will enter the heart,
but if they come from the tongue  they will not pass beyond the ears.

Shaykh Shihab al-Din al-Suhrawardi
(Radi Allahu ta'ala anhu)

Introduction

Origins

'Awarif al-Ma'arif

Nearness to God

Suhbah - Gathering

Adaab (Some lessons in eating)

 
The Mureed and Shaykh Relationship

The Book of Radiance

What other scholars have said

Gallery


Also visit Silsila al-Qadiriya, Silsila al-Chistiya,
Silsila al-Naqshbandiya & Silsila al-Ashrafiya

http://wp.greenmountainschool.org/publications/the-defense-of-the-sunnah-an-analysis-of-the-theory-and-practices-of-tasawwuf-sufism/


Hizb al Nasr
The Prayer of Victory

by Shaykh Abu Hassan As-Shadhuli (rahimullah)

 https://www.angelfire.com/d20/muraqaba/texts.htm

Hizb an-Nasr, Orison of Victory is a powerful litany by renowned Sufi Shaykh Abul Hasan ash-Shadhdhuli (raheemullah). It is recommended to recite the highly meritorious Hizb an-Nasr to invoke Allah's help, blessing and guidance for people who are in need in the Ummah. Indeed it has benefit and concealed secrets in it for those who recite.

It was written about 800 years ago at the time Shaykh Abu Hassan As-Shadhuli was fighting against the Crusaders, led by King Louis IX of France. The Crusaders were trying to invade through the city of Mansura. This Hizb is also called as-Saif as-shadhili (The sword of shadhili).

This highly potent du'a was recited by renowned Shaykh Muhammad Ibn Nasir and across Morocco, and inspired resistance to the French Occupation. So powerful was it that the French President had to issue an order banning its recitation from the mosques. Moroccans date the movement to return King Muhammad from that outlawing of the du'a. It is appropriate to the present state of the Ummah. 

Towards the end of his life, Abul Hasan Shadhili's eye sight started to become weaker. He was slowly losing his eye sight but it didn't prevent him from fighting in the front line of the battle of al-Mansurah when the Crusaders forces under King Louis of France invaded Misr (Egypt) in 1250. His age was approximately 54 then.

Shaykh Abul Hasan and many of his muridun (spiritual disciples), friends from amongst the 'ulama' (scholars) and awliya (saints of God) upon hearing that the ummah (muslim community) was under attack, immediately made their way to al-Mansurah to fight in the front line seeking Victory or Paradise as Martyr (an Nasr aw al-Jannah). Allah (Ta'ala) gave the Muslims victory.

 

حزب النصر
Hizb al-Nasr

اللهم بسطوة جبروت قهرك، وبسرعة إغاثة نصرك، وبغيرتك لانتهاك حرماتك، وحمايتك لمن احتمى بآياتك،
Allahumma bisatwati jabarouti qahrika, wa bisorati ighathati nasrika, wa bighayratika li ntihaki horumaika, wa himayatika liman ihtama bi ayatik.
O Allah, by the force of the absolute power with which You triumph, and the quickness of Your succour when You aid to victory, and Your jealousy at the violation of things You have made sacrosanct, and by Your protection of him who seeks safety in Your verses:


نسألك يا الله يا سميع يا قريب يا مجيب يا سريع يا منتقم يا شديد البطش يا جبار يا قهار يا من لا يعجزه قهر الجبابرة ولا يعظم عليه هلاك المتمردة من الملوك والأكاسرة أن تجعل كيد من كادنا في نحره ومكر من مكر بنا عائدا عليه، وحفرة من حفر لنا واقعا فيها ومن نصب لنا شبكة الخداع، اجعلها ياسيدي مساقا إليها ومصادا فيها وأسيرا لديها،
Nas'aloka ya Allah,ya Samee’o,ya Qareebo, ya Saree’o, ya Montaqimo, ya Shadeeda l-batshi, ya Jabbaro, ya Qahhar, ya man la yo’jizohu qahro l-jababirati mina l-molooki wa l-akasirah, an taj’ala kayda man kadana fi nahrihi, wa makra man mkara bina ‘a'idan ‘alayhi, wa hofrata man hafara lana waqi’an fiha, wa man nasaba lana shabakata l-khida’i j’alho ya sayyidi mosaqan fiha, wa mosadan fiha, wa 'aseeran ladayha.
I ask You, O Allah, O All-near, O All-hearing, O All-answering, O Ever-swift, O Vengeful, O Mighty of Assault: O Compeller, O Invincible, O You who are undeterred by the might of tyrants, and to whom the destruction of rebellious traitors, of kings and caesars, is very easy: make the trap of him who sets one for me cut his own throat; the plot of him who plots against me return against him; and make him who digs a pit for me fall in it himself; And he who spreads a web of treachery for me, make him, My Lord, driven to it and caught in it.


اللهم بحق كهيعص اكفنا هم العدا ولقهم الردا واجعلهم لكل حبيب فدا. وسلط عليهم عاجل النقمة في اليوم والغدا.
Allahomma bihaqqi Kaf ha ya ‘ayn sad ikfina hamma l-ida. Wa laqqihimo r-rada. Wa j’alhom likolli habibin fida. Wa sallit ‘alayhim ‘ajila n-naqmati fi l-yawmi wa l-ghada.
O Allah, by the right of Kaf Ha Ya ‘Ayn Sad relieve us of the worry of enemies, let them meet with death, make them the ransom of every beloved, and loose upon them a speedy vengence, day and night.
اللهم بدد شملهم. اللهم فرق جمعهم. اللهم أقلل عددهم. اللهم فل حدهم. اللهم اجعل الدائرة عليهم. اللهم وأوصل العذاب إليهم. اللهم أخرجهم عن دائرة الحلم. واسلبهم مدد الإمهال. وغل أيديهم وأرجلهم واشدد على قلوبهم ولا تبلغهم الآمال.
Allahomma baddid shamlahom. Allahomma farriq jam’ahom. Allahomma aqlil adadahom. Allahomma folla haddahom. Allahomma j’ali d-da'irata ‘alayhim. Allahomma awsili l-athaba ilayhim. Allahomma akhrijhom min da'irati l-hilm. Wa slobhom madada l-imhal. Wa gholla aydeehim wa arjolohom, wa shdod ‘ala qoloobihim, wa la toballighohomo l-a'amal.
O Allah, scatter their company; O Allah shatter their unity; O Allah, lessen their number; O Allah, blunt their edge; O Allah, turn fate against them; O Allah, unleash torment upon them; O Allah, banish them from the circle of clemency, and strip them of the benefit of postponement, and fetter their hands and feet, and blind their hearts, and give them no hope.


اللهم مزقهم كل ممزق مزقته لأعدائك انتصارا لأنبيائك ورسلك وأوليائك
Allahomma mazzikhom kolla momazzaqin mazzaqtaho li 'a’daaika n-tisaran li anbiya'ika wa rosolika wa awliya'k.
O Allah, rend them utterly to pieces, as You have rent Your enemies, to win the day for Your prophets, messengers and You beloved ones.


اللهم انتصر لنا انتصارك لأحبابك على أعدائك (3)
Allahomma n-tassir lana n-tisaraka li ahbabika ‘ala a’daa'ik. (3)
O Allah, give us the victory You give to those You love over Your enemies. (3)


اللهم لا تمكن الأعداء فينا ولا تسلطهم علينا بذنوبنا (3)
Allahomma la tomakkini l-a’daa'a fina, wa la tosallithom ‘alayna bi-thonoobina (3)
O Allah, do not let Your enemies defeat us, nor give them power over us because of our sins. (3)


حم، حم، حم، حم، حم، حم، حم
Ha Mim, Ha Mim, Ha Mim, Ha Mim, Ha Mim, Ha Mim, Ha Mim,
Ha Mim, Ha Mim, Ha Mim, Ha Mim, Ha Mim, Ha Mim, Ha Mim,


حم الأمر وجاء النصر فعلينا لا ينصرون
Homma l-amro wa ja'a n-nasro fa ‘alayna la yonsaroon.
The matter be done; the victory come; against us they shall not be helped.


حمعسق حمايتنا مما نخاف.
Hamim ‘Ayn Sin Qaf himayatona mimma nakhaf.
Ha Mim ‘Ayn Sin Qaf is our protection from what we fear.


اللهم قنا شر الأسواء ولاتجعلنا محلا للبلواء. اللهم أعطنا أمل الرجاء وفوق الأمل.
Allahomma qina sharra l-aswa'i, wa la taj’alna mahallan lil balwa. Allahomma a’tina amala r-raja'i wa fawqa l-amal.
O Allah, shield us from the evil of iniquities, and make us not a place of tribulation. O Allah, give us cause to hope, and more than hope.


يا هو يا هو يا هو
Ya hoo. Ya hoo. Ya hoo
O You, O You, O You,


يا من بفضله لفضله نسألك العجل العجل. إلهي، الإجابة الإجابة.
Ya man bifadhlihi lifadhlihi, nas'aloka l-‘ajala l-‘ajal. Ilahi l-'ijabata l-ijabah.
O You from whose favor we ask of His favor that it be fast, fast, fast. O my God, An answer, An answer.


يا من أجاب نوحا في قومه، يا من نصر إبراهيم على أعدائه، يا من رد يوسف على يعقوب. يا من كشف ضر أيوب. يا من أجاب دعوة زكريا. يا من قبل تسبيح يونس بن متى.
Ya man ajaba Nouhan fi qawmih, ya man nasara Ibrahim ‘ala a’daa'ih, ya man radda Yousofa ‘ala Ya’qoob, ya man kashafa dhorra Ayyoub, ya man ajaba da’wata Zakariyya, ya man qabila tasbeeha Younosa bni Matta.
O You who answered Noah about his people. O You who made Abraham triumphant over his foes. O You who reunited Joseph with Jacob. O You who lifted the affliction of Job. O You who answered the prayer of Zachariah. O You who accepted the praises of Jonah son of Amittai.


نسألك بأسرار هذه الدعوات أن تقبل ما به دعوناك، وأن تعطينا ما سألناك. أنجز لنا وعدك الذي وعدته لعبادك المؤمنين.
Nas'aloka bi-asrari hathihi d-da’awat an taqbala ma bihi da’awnak, wa an to’tiyana ma sa'alnak Anjiz lana wa’daka l-athi wa’adtaho li ‘ibadika l-mo'mineen.
O Allah, by the secrets of those supplications,  we beseech You to accept our supplications, and give us what we have asked, and keep Your promise You have given Your believing servants.


لا إله إلا أنت سبحانك إني كنت من الظالمين.
La ilaha illa anta, sobhanaka, inni konto mina dhalimeen.
“There is no god but You. Exalted is Your perfection; verily I was of the wrongdoers”


انقطعت آمالنا وعزتك إلا منك، وخاب رجاؤنا وحقل إلا فيك.
Inqata’at aamalona, wa izzatoka, illa mink. Wa khaba raja'ona, wa haqqoka, illa feek.
Our wishes come to nothing- I swear by Your might- except from You; and our hopes are dashed- I swear by Your right- except in You.


إن أبطأت غارة الأرحام وابتعدت، فأقرب الشيء منا غارة الله.
In abta'at gharato l-arahami wa bta’adat, fa aqrabo sh-shay'i minna gharato l-Lah.
If the rescue raid of kinsmen be slow and far off, the nearest thing to us is the rescue raid of Allah.


يا غارة الله جدي السير مسرعة في حل عقدتنا.
Ya gharata l-Lahi, jiddi s-sayra mosri’atan li halli ‘oqadatina.
O raid of Allah, fly with haste to end our plight.


يا غارة الله عدت العادون وجاروا ورجون الله مجيرا.
Ya gharata l-Lahi, ‘adati l-‘adoon wa jarou, wa rajawna l-Laha mojeera.
O raid of Allah, wrongdoers have assailed us and transgressed; and Allah we seek  YOU( ALLAHOO) as Protector.


وكفى بالله وليا وكفى بالله نصيرا.
Wa kafa bi l-Lahi waliyan wa kafa bi l-Lahi naseera.
And Allah suffices as friend; and Allah suffices as helper.


وحسبنا الله ونعم الوكيل
Wa hasbona l-Laho wa ni’ma l-wakeel.
“Allah suffices us and is best to rely on”


ولا حول ولا قوة إلا بالله العلي العظيم
Wa la hawla wa la qowata illa bi l-Lahi l-Aliyyi l-Adheem.
“There is no power or strength except through Allah, the High, the All-great”


سلام على نوح في العالمين
Salamon ‘ala Nouhin fi l-‘alameen.
Peace be with Noah among people.


استجب لنا آمين.
Istajib lana, ameen.
Answer us. Ameen.


فقطع دابر القوم الذين ظلموا والحمد لله رب العالمين
Fa qoti’a dabiro l-qawmi l-latheen dhalamoo, wa l-hamdo li-Lahi rabbi l-‘alameen.
“the wrongdoing folk were extirpated, and praise be to Allah Lord of the Worlds”


وصلى الله على سيدنا محمد وعلى آله وصحبه وسلم.
Wa salla l-Laho ‘ala sayyidina Mohammadin wa ‘ala aalihi wa sahbihi wa sallam.
Allah bless our lieglord Mohammad, and his folk and Companions, and truly give them peace.



Here is the recount Shaykh Abul Hasan from the Orison of The School of the Shadhdhuliyyah, volume one:

On the day of the battle he (Shaykh Abul Hasan) mounted his best horse and had one of the muridun hand him up his sword. When he had his sword to hand he asked for another, and with a sword in his right hand and a sword in his left hand he rode into battle. When asked later, given his deteriorating eyesight, how he could have ridden into battle and so honourably acquitted himself on the battle field he simply pointed to his heart saying: "If the eye of the heart sees clearly what need is there for my eyes?” such was his vision.

From the Orison of The School of the Shadhdhuliyyah, volume two we get more clearer picture of the famous battle of Mansurah:

It was Louis IX, King of France, leading the vast combined armies of the Crusaders. The desire of the King was to bring down and subdue Islam in a final decisive battle. The combined forces of the West were fully prepared to attack Misr (Egypt) in a battle that is often compared with the Battle of the Trench (ghazwatul kahndaq).

The shaykh had a profound veridical dream (ru'ya) just before the battle where he was given a vision of a huge tent, an expansive pavilion mounting into the sky, light shone upon it and it was teeming with heavenly people. When asked in the dream, to whom this tent belong, it was said, "To the Prophet of Allah, peace and blessings upon him.” In the later part of the dream the Prophet spoke to Shaykh Abul Hasan and gave him advice. King Louis lost despite superior military power and he was captured in the battle along side with many of his generals. Allah gave the Muslims victory.

Nasr min Allahi wa fathun Qarib,
wa Bashiril Muminin.

Help is from Allah and Victory is Near.
Give good news to the believers.
- The Quran 61:13

O Allah, make us all steadfast with the recitation of Hizb al-Nasr for the victory of Muslims over our foes. Ameen.

http://privat.bahnhof.se/wb042294/Texter/shadhili-awrad_index.html#bahr

 

  

http://webspace.webring.com/people/vm/mutmainaa/victory_dua.html

IF YOUR AN ALIM OR ALIMA, TRYING TO RAISE FUNDS FOR YOUR MASJID OR MARRIAGE,  or JUST LIVELY-HOOD, like Shaykh Muhtar Holland, Shaykh Ha Meem Nuh Keller & other Sufi Lovers,(MAY ALLAH BLESS THEM) I suggest you follow in their footsteps,& lifestyle by translating & transliterating great DUAS of the Greatest Men in the History of Islam, inshALLAHutalah!!!

http://wp.greenmountainschool.org/publications/the-defense-of-the-sunnah-an-analysis-of-the-theory-and-practices-of-tasawwuf-sufism/

duafromhadith.jpg

http://www.ummah.net/Al_adaab/audio/Manzil_Ayatus_Shifaa.mp3" >Protective Ayaah and the Healing Ayaah beautifully recited by Qari Muhammad Ismail Qadri Sahib

*Note: Used in the renown Al Jilaani Methodology of Quranic therapy

http://www.iqou-moa.org/sheikh_jilani of Qur'anic Therapy for healing physical and non physical diseases. by the Blessings of Sayyidinaa wa Mowlana Muhammadin wa 'Alaa 'Aalihi wa Sahbihi wa Barik wa Sallim. MAY ALLAH GIVE US ALL SHEFAA & THE ABILITY TO LEARN ALL THE BEST ISLAMIC ETIQUETTES, ESPECIALLY WHEN IT COMES TO MARRIAGE, AMEEN

 
 
http://www.amazon.ca/s/ref=nb_sb_noss?url=search-alias%3Daps&field-keywords=pinhole%20glasses
 
 I recently purchased Dr. Bate's PRESCRIPTION FREE pinhole glasses, and I was amazed I could read clearly what was written in the TTC subway train with out my OVVO optics prescription glasses,
 
 
 The Holy Islamic way of healing the eyes: https://www.youtube.com/watch?v=DJTd0TdCFDU  can be a compliment to other methods, such as those being conducted by Dr. John Yee, Certified Psychotherapist of NewGen Optical .
 
 
 
 
 

 

 

Doctor Wallach,  Author of the book 

Dead Doctor's Don't Lie,
 
has stated he can take Diabetic people of Diabetes check out his article at:
 
 
I suggest Doctor Wallach, the maker of the pill known as "Imortalium", have a televised and recorded debate with Dr. James Pontolillo, a research scientist with over ten years of experience in the fields of geology, organic petrology and organic geochemistry, we shall then judge if taking his pills &/or colloidal minerals can be beneficial or can taking them lead to dangerous diseases, Na-Ozbillah-May ALLAH FORBID, AMEEN
 
http://imortalium.com/
 
 
 
 
 

 
 
 
https://www.healthtalklive.com/wp-content/uploads/2012/07/MELISA-questionnaire.pdf http://nourishedkitchen.com

TEST FOR THE BEST

owayseeyahflag.jpg
https://healingtheeye.com/
The Salihiyya order, like the closely related Idrisiyya, Rashidiyya, & Sanusiyya orders, is a revivalist reform movement & historically was staunchly opposed to the Qadiriyya order (which is the largest & longest-established in Somalia), taking issue with the Qadiri doctrine of tawassul (intermediation). While the Qadiriyya upheld the traditional Sufi belief in the power of Intercession held by dead saints, the Salihiyya maintained that only living saints held this power. The Salihiyya was also militantly anti-colonial. Mohammed Abdullah Hassan, a Salihiyya Shaykh & Poet, spread the Salihiyya (particularly in Ogaden) & led an armed anti-colonial resistance movement in the Horn of Africa under the auspices of the order.
Recite Fatiha for Syed Mustafa bin Salman al-Jilani NafunAllahuBee, the Baghdadi Murshid of Shayk Ovays Ahmed Walee-Allah, & may ALLAH join us with his company on the Yaumil Qeeyahmah as part of the Jury in the Salihiyya V.S Ovaysee Qadariyya Gang-War & Murder Case of Shayk Ovays Ahmed Walee-Allah, Ameen Ya Hakimul Hakimeen!
Shayk Uways Ahmed WaliAllah Barawi NafunAllahuBee composed numerous religious poems that were included in the Majumua Qasaid fi Madh Sayid Al-Ambiya (A Collection of Qasidas in Praise of the Master of Prophets-SullAllahwalahee wa Salim). Shayk Uways's teacher Shaykh Sufi & Al-Zayla'i's poems also feature in the text. The Qasida entitled Hadiyat al-Anam ila Qabr al-Nabi (Guidance of Humanity to the tomb of the Prophet) seems fantastic, like all the others in the Sufi books:Al-Jawahir al-Nafis & Jala al-Aynayn. My favourite Qaseeda is: "La eelaha ill-ALLAH-Taj-Allah Nur", I hope Shayk Tauhdeed Tufail of Surrey, BC or someone qualifed will have it translated & distributed, with mass production in freshly printed books &/or websites in the near future, in Sha ALLAH bee Iznillah Be Barkatay Surah Al-Fatiha wa Be Azmathay ALLAHU RABBANA DHUL JALAALEE ALLAHU RABBANA DHUL KAMALEE. My Murdered Friend of Qeeyamah time,the Best in Habashee Rythem & Rhyme "OWAYS AHMED WALEE-ALLAH" is also the Maternal Grandfather of my Somalian Murshid Muhammed Shah Abdullahee NafunAllahuBee. On the Yewmil Qeeyamah, I hope to sit in the Jury Seat, to Witness ALLAH's Judgement on the Mad-Mullah, in the murder case of Shayk Uways

measachildinindiamakingdua.jpg

Red Rose, Spinning