Make your own free website on Tripod.com

labaik.jpg

I love reading BASHAIRUL KHAYRAATH!!!!
fromfazailsadaaqat.jpg
https://www.facebook.com/tariqahusseiniyaqadiriyya/?hc_ref=ARQG7CcLulLm5TMFnxcpNRoxUmVARQwr4R3yEJrZz

Narrated: Hadruth AbuUmamahRadee-AllahuAnhu, The Prophet (SullAllahWalaheewaSalim) said:

I guarantee a house in the surroundings of Paradise for a man who avoids quarrelling even if he were in the right, a house in the middle of Paradise for a man who avoids lying even if he were joking, and a house in the upper part of Paradise for a man who made his character good.

(Sunan Abi Dawud Book 43, Hadith 28. English translation: Book 42, Hadith 4782)

I hope someone who is a friend of Tareeqah Uwaisi Qadiriya will translate & transliterate all the books & Qaseedaas of Shaykhina Uwais Ahmed WaliAllah, especially, the one known as: TAJALLAH NOOR, LA ILAH ILL ALLAH TAJALLAH NOOR MUHUMMADRASOOLALLAH TAJALLAH NOOR, SHAYKH ABDUL QADIR SHAY-INILLAH TAJALLAH NOOR TAJALLAH NOOR, OWAIS AHMED WALEE-ALLAH TAJALLAH NOOR TAJALLAH NOOR

https://www.facebook.com/tariqahusseiniyaqadiriyya
flaqofofowaiseeqadiriya.jpg

MAY ALLAH GIVE US ALL THE COURAGE TO PRAY SOUTH-EAST IN NORTH AMERICA, INSHA, ALLAH http://www.qiblah.us/

Click on this photo, pray SOUTH EAST, inShA-ALLAH
southeastisthecorrectqiblah.jpg
http://www.masjidtucson.org/submission/practices/salat/QiblahSouthEastUSAandCanada.pdf

ALLAHU AKBAR ALLAHU AKBAR ALLAH ALLAH (Jaanbaz Qawallee)

Wafu-Anna Wagh-Firlana Wur-Humna

Don't pray North East like the Scared Fools tell you to, in North America! Fear ALLAHuuQAHAAR Not them!!! Click on this link and Sign my Guest Book if you agree or disagree!

My Great Sunni Grandfather Imam Muhammad al-Baqir KarmAllaho Wajhu Alaih Salaat wa Salaam NafunAllahu-Bee has said:
“The scholar whose Knowledge is made use of & benefited from, 
is worthier & more virtuous than seventy thousand worshipers & adorers.” 

https://www.duas.org/sayings.htm

idrewthisturbanofgreenlightmashallah.jpg
---------------------------786

File for FREE with TURBO TAX!!!

ANQA PUBLISHING

My Heart has become capable of all forms:

For gazelles, a meadow, for monks, a monastery.

A temple for idols, the pilgrim's Kabah,

The Tablets of the Torah, the Book of the Qur'an.

I profess the religion of Love, and whatever the direction

Taken by it's mount, Love is my religion and my faith.

Excerpt from Ibn Arabi's poetic collection:"Tarjuman", XI, vv. I3-6, pp.4 3-4.

Hadruth Shaykha Al-Akbar Muhyideen Ibn ‘Arabi (or Ibn al-‘Arabi, as he is also known), is a towering figure in world spirituality. His peerless exposition of the Unity of Existence, which has had a deep and continuing influence on Sufism and the wider Islamic world, is now increasingly being appreciated in the West. Ibn ‘Arabi’s message is not just for mystics, but for all who want to want to understand their true relationship with God and what it really means to be human. His profound vision is certainly as important in today’s world as it ever has been.

Do not betray anyone who places his trust in you, even if he betrays you, and do not disclose his secrets, even if he discloses you
Today there are deeds and no judgment, and tomorrow there will be judgment and no deeds.
Anger is like a ball of fire, but if you swallow it, it’s sweeter than honey.
Keep your thoughts cleaner than pure water. As water drops make a river, thoughts make character and faith.
- Hadruth Imam Ali KarmAllahu
Wajhu Alaih Salaatu Salaam NafunAllahuBee

https://www.pinterest.com has great photos too!!!

https://plus.google.com/collection/QwSKRE

IF YOU LOVE YOUR HEALTH AND THE BIRDS GLORIFYING ALLAHU-KHAIRUR-RAZIQ-QEEN, PREVENT MORE TOXIC TOWNS!INSHA-ALLAH http://www.chatelaine.com/health/canadas-toxic-town/ INSHA-ALLAH: https://vimeo.com/25563376

http://fitlife.tv/flu-vaccine-contains-25000-times-more-mercury-than-is-legally-allowed-in-drinking-water-original/

http://science.naturalnews.com/vaccines.html

https://coalitionofontariodoctors.ca/stopbill41/#form

http://www.vanvcd.org/start.php

The Great Anti-Vaccine Book "JABBED" Should by made into a Canadian Movie, inShALLAH

By Brett Wilcox

TERRORSTORM

“The very word "secrecy" is repugnant in a free and open society; and we are as a people inherently and historically opposed to secret societies, to secret oaths and to secret proceedings...Our way of life is under attack. Those who make themselves our enemy are advancing around the globe...no war ever posed a greater threat to our security. If you are awaiting a finding of "clear and present danger," then I can only say that the danger has never been more clear and its presence has never been more imminent...For we are opposed around the world by a monolithic and ruthless conspiracy that relies primarily on covert means for expanding its sphere of influence–on infiltration instead of invasion, on subversion instead of elections, on intimidation instead of free choice, on guerrillas by night instead of armies by day. It is a system which has conscripted vast human and material resources into the building of a tightly knit, highly efficient machine that combines military, diplomatic, intelligence, economic, scientific and political operations. Its preparations are concealed, not published. Its mistakes are buried, not headlined. Its dissenters are silenced, not praised. No expenditure is questioned, no rumor is printed, no secret is revealed.” ― John F. Kennedy

Outer-space satellites could of lead the Illuminati http://www.urbandictionary.com/define.php?term=Illuminati to a new idea, a NEW WORLD ORDER: http://www.threeworldwars.com/new-world-order.htm (the 9-11 inside job), as per the hadith, the river Euphrates shall uncover a Mountain of Gold: Allah's Messenger (peace be upon him) said: “The Last Hour will not arrive until the Euphrates uncovers a mountain of gold, over which people will fight. Ninety-nine out of every hundred will die but every man amongst them would say that perhaps he would be the one who will be saved (and thus possess the gold).” [Sahîh Muslim]  

Due to the RISE of BEGGERS, at Wi-Fi hotspot restaurants, vote for the party that will offer Unlimited-FREE High Speed Internet for all jobless, incomeless people, raise TAXES for companies that promote SUGARY-GMO-Chemical Foods, and offer TAX CREDITS to buy Halaal Certified ORGANIC FOODS, inSHALLAH

https://youryuckymouth.com/ca/

http://www.energygrid.com/health/2006/11kf-persona
allahsblessedname.jpg
http://www.essentialdayspa.com/forum/viewthread.php?tid=27459

Which toothbrush is Better Ionic or Sonic?

https://plus.google.com/collection/QwSKRE
babasayyidkasimudeanalikkhanrahmuthallahalaih.jpg

I LOVE USING GREEN-BEAVER PRODUCTS BECAUSE THEY ARE CERTIFIED BY ECOCERT Greenlife according to ECOCERT Standard availale at:

CHEMICALS DETERGENTS SUCK!!! http://www.ecocert.com/en/natural-and-organic-cosmetics

If your worried about parcel theft, I suggest you get it from Penguin Pick-up.com

Before you make a vote in the Elections. I suggest you request from our Government to inform us what is the Flouride content and PH level of the Tap Water we are drinking, inSHALLAH

If your fish get's sick will you give it a pill or just change the water www.peachtreehealthfoods.com

ENERGYGRID HEALTH



Thana (Glorification):Transliteration:Subhana ka-Allahumma wa bee- Humdeeka wa tabarakas-moka wa ta'Ala juddoka wa Laa Ee-laha  ghaay-ruk.

Translation: Holy art Thou, O Allah, and all praise is Thine; blessed is Thy name, and exalted is Thy state. There is none worthy of worship except Thee alone. 

Ta'awwz (Seeking Allah's Protection from Satan the Accursed)

Transliteration: A'ouzo billahi min-aash-shaaytaan-nir-rajeem.
Translation: I seek refuge with Allah from Satan, the accursed.

Bismillahir Rahmanir- Raheem.

 Nahmahdo Wa Nusallee ala Rasoo-lahil Kareem


I hope our Government will BAN styrofoam/   http://mamashealth.com/environmentalhealth/styrofoam.asp
  Fast-Food containers and Plastic Water Bottles, http://www.smart-publications.com/articles/the-truth-about-plastic-water-bottles/ inShALLAH

https://www.modernghana.com/lifestyle/3733/16/eating-hot-food-in-plastic-containers-can-lead-to-.html

http://www.yorku.ca/susweb/resources/documents/Bottled_water_facts_002.pdf

Salawaat of Al-GhawthAlAdhamee Alaih Salaam
geylanisalawat.jpg
https://plus.google.com/collection/QwSKRE

This dua is attributed to Hadruth Abu Darda R.A
abudardarahmuthallahalaihmadethisdua.jpg
This dua can avert a tragedy from happening, inShALLAH

shaykhhazimskhalwaroominhighnazulamaanjordan.jpg

allahualeem.jpg

http://www.muslimfootsteps.com/?q=Habeel-and-Qabeel

psx_20180105_234028.jpg

shaykmustafayucelszickerissoawesomeiwishhelivedbesidemeinshallah.jpg
Click on this Photo to make Zikr with us, inShALLAH

Shaykh Mustapha Yucel  makes awesome Zikr.  I miss this man of great learning. He spent twenty years in the deserts of Iraq and had sat at the feet of men like Shaykh Ahmad ar-Rawi - a great wali of Allah, who was sent by the Osmanli Dawlah to Madras as Qadi - Shaykh Salah Eid, and Shaykh Ayyub Khatib each one of them passed on to him the idhn to teach Islam and spread the Tariqah. ~Hasbullah Syafiiy

Muhammed Rafi's Qawaali on Adam Alaih Salaam
mayallahmakeuskudus.jpg
https://www.youtube.com/watch?v=qGteHpHYKwM

http://www.khaleejtimes.com/nation/sharjah/sharjah
ihopesomeonewillputpeacockfeathersonmygravewhenipassawayinshallah.jpg
http://www.sharjahlightfestival.ae/en/programme/sharjah-university-khorfakkan/

The Power of Salawat on Prophet ﷺ

Al-Hafizh as-Sakhawi (q) mentioned:
In the time of Bani Israel there was one person that transgressed against everything. He didn’t keep any Shari`ah and had no imaan and may have killed people and was doing all kinds of wrong. When he died, they threw him in a well and then Allah (swt) revealed to Sayyidina Musa (alaih Salaam), “Today one of my saints has died. Go and pray on him and bury him as I forgave him.”

Sayyidina Musa (alaih Salaat wa Salaam) asked, “Why did you forgive him? He was a gangster.”Allah (swt) replied, “One day he opened the Tawrat and found the name of the Prophet ﷺ, and he recited salawaat on him, and for that I forgave him.”

So recite after me:

Allahumma salli `alaa sayyidinaa Muhammadini 'l-faatihi limaa ughliqa, wa 'l-khaatimee limaa sabiqah, naasiri 'l-haqqi bi 'l-haqqee, wa 'l-haadee ilaa siraatika 'l-mustaqeem, wa sull-Alaa aalihee haqqa qadreehee  miqdaarihi 'l-`adheem

http://www.reflectionsofiman.com/the-explanation-of-the-hadith-of-man-who-killed-99-men/

hisblessedfoothasblessedmeatbabulshaykh.jpg

Alhamdulliah I had dinner beside him, in Baghdad
shayksalehkaylaaneeradiallahuanhu.jpg
Please let me know if Fatima Bibi still has the room beside him

Lutfullah (Arabic: لطف الله ‎), meaning kindness of God, is a male given name

https://www.youtube.com/watch?v=FAZ4ara0q-c
mygimpartphoto.jpg
https://www.youtube.com/watch?v=JmNiKeJq-T4

I hope you click on my Photograph and watch the Buyan on Hudruth Hud Alaih Salaatu wa Salaam, and then listen to one of my favourite Maulana Hadadee Raheemullah Qasaid: YA ALIMU Sirri MiNNA!

hadruthyusufbinismaeelannabahanee.jpg
https://seekerofthesacredknowledge.wordpress.com/2012/11/01/the-tariqa-of-shaykh-yusuf-al-nabhani-al

Click on this link to get the Salaat timings in the GTA area, inShALLAH: http://www.shariahprogram.ca/prayer-timings-Toronto-times.shtml
 

The Tariqa of Shaykh Yusuf al-Nabhani Alayhi Rahma:

The Righteous Scholar, The Zahid and Friend of Allah Asavajal, Shaykh Yusuf al-Nabhani (Allah have mercy on him) was born in Ijzim in 1849.   He was one of the Poets of Rasul Allah Sallallahu Alayhi Wasallam and was one of the Mujaddids of Shaam as-Sharif.

The Shaykh (Allah have mercy on him) took from many Sufi Tariqa’s, some of them were:

The Idrisi tariqa from Hazrat Shaykh Ismail al-Nawab Alayhi Rahma

The Shadhili Tariqa from Hazrat Shaykh Muhammad Ibn Masoud al-Fassi Alayhi Rahma and  Hazrat Shaykh Ali Nuruddin Ali Cherti Alayhi Rahma

The Naqshbandi Tariqa from Hazrat Shaykh Ghiasuddin al-Arbali Alayhi Rahma

The Qadri Tariqa from Hazrat Shaykh Hassan Ibn Abi Halwah al-Ghazi Alayhi Rahma

The Rifai Tariqa from Hazrat Shaykh Abdul Qadir Bin Abi Rabah Dajani al-Yafi Alayhi Rahma

The Khalwati Tariqa from Hazrat Shaykh Hassan Ridhwan al-Saidi Alayhi Rahma

Some Poetry on The Blessed Sandal of Rasul Allah Sallallahu Alayhi Wasallam by Shaykh Yusuf al-Nabhani Alayhi Rahma:

“It is not for the image that my heart is longing – it yearns for the one who wore this sandal.”
Here is a Translation of a Arabic Qasida written by Yusuf Nabhani(Rehmatullahi Alaih)

The intresting thing is that this Qasida is present on a Deobandi Site... 
http://alchishti.wordpress.com/2006/...ant-him-peace/


Al-Haqiqat al-Muhammadiyya

I am the slave of the Master of Prophets ( Translated into English on April 14, 2006)
By Shaykh Yusuf Nabhani (Allah have mercy on him)
I am the slave of the Master of Prophets
And my fealty to him has no beginning.
I am a slave of his slave, and of his slave's slave,
And so forth endlessly,
For I do not cease to approach the door
Of his good pleasure among the beginners.
I proclaim among people the teaching of his high attributes,
And sing his praises among the poets.
Perhaps he shall tell me: "You are a noted friend
Of mine, a truly excellent beautifier of my tribute."
Yes, I would sacrifice my soul for the dust of his sanctuary.
His favor should be that he accept my sacrifice.
He has triumphed who ascribes himself to Him!
- Not that He needs such following,
For He is not in need of creation at all,
While they all need him without exception.
He belongs to Allah alone, Whose purified servant he is,
As his attributes and names have made manifest;
And every single favor in creation comes from Allah (asvajal)
To him, and from him to everything else


http://sunniforum.net/showthread.php?t=10768

miladunabeeisbeautifullycelebratedbythebestofthebest.jpg

goldenpenofsalawaat.jpg

mein1994.jpg

No written description of our beloved Prophet (peace and blessing be upon him) can ever do justice to his exceptional beauty.
Sadatheena Aiesha Sideeqa Radhee-Allahu Anha, the wife of the Prophet (may Allah be pleased with her) described him as being more handsome than Prophet Joseph for whom the wives of Pharaoh’s ministers slit their hands on account of his handsome appearance.

She said “If the friends of Zulayka had seen the blessed face of the Messenger of Allah (peace and blessing be upon him) they would have cut their hearts instead of their hands!”

 A portion of Prophet Mohammed’s inner beauty manifested itself externally and illuminated his very being. Kurtubi, a great scholar of Islam, said that if his entire beauty had been made manifest, it would have been impossible for anyone to look at him.

http://www.healingtheeye.com/resources/books_cds.h
themasjidinthebackgroundismasjidkuttakeenabalow.jpg

https://blossompure.wordpress.com/products/
idrewthisturbanofgreenlightmashallah.jpg
https://blossompure.wordpress.com

ﺍَﻟﺼَّﻼَﺓُ ﻭَﺍﻟﺴَّﻠَﺎﻡُ ﻋَﻠَﻴْﻚَ ﻳَﺎ ﺭَﺳُﻮﻝَ ﺍﻟﻠّٰﻪِ،
ﺍَﻟﺼَّﻠَﺎﺓُ ﻭَﺍﻟﺴَّﻠَﺎﻡُ ﻋَﻠَﻴْﻚَ ﻳَﺎ ﺣﺒﻴﺐَ ﺍﻟﻠّٰﻪِ،
ﺍَﻟﺼَّﻠَﺎﺓُ ﻭَﺍﻟﺴَّﻠَﺎﻡُ ﻋَﻠَﻴْﻚَ ﻳَﺎ ﻧَﺒِﻰَّ ﺍﻟﻠّٰﻪِ،
ﺍَﻟﺼَّﻠَﺎﺓُ ﻭَﺍﻟﺴَّﻠَﺎﻡُ ﻋَﻠَﻴْﻚَ ﻳَﺎ ﺧﻠﻴﻞ ﺍﻟﻠّٰﻪِ،
ﺍَﻟﺼَّﻠَﺎﺓُ ﻭَﺍﻟﺴَّﻠَﺎﻡُ ﻋَﻠَﻴْﻚَ ﻳَﺎ ﺻَﻔِﻰَّ ﺍﻟﻠّٰﻪِ،...

ﺍَﻟﺼَّﻠَﺎﺓُ ﻭَﺍﻟﺴَّﻠَﺎﻡُ ﻋَﻠَﻴْﻚَ ﻳَﺎ ﻭَﻟِﻰَّ ﺍﻟﻠّٰﻪِ،
ﺍَﻟﺼَّﻠَﺎﺓُ ﻭَﺍﻟﺴَّﻠَﺎﻡُ ﻋَﻠَﻴْﻚَ ﻳَﺎ ﺧَﻴْﺮَ ﺧَﻠْﻖِ ﺍﻟﻠّٰﻪِ،
ﺍَﻟﺼَّﻠَﺎﺓُ ﻭَﺍﻟﺴَّﻠَﺎﻡُ ﻋَﻠَﻴْﻚَ ﻳَﺎ ﻧُﻮﺭَ ﻋَﺮْﺵِ ﺍﻟﻠّٰﻪِ،
ﺍَﻟﺼَّﻠَﺎﺓُ ﻭَﺍﻟﺴَّﻠَﺎﻡُ ﻋَﻠَﻴْﻚَ ﻳَﺎ ﺍَﻣﻴﻦَ ﻭَﺣْﻰِ ﺍﻟﻠّٰﻪِ،
ﺍَﻟﺼَّﻠَﺎﺓُ ﻭَﺍﻟﺴَّﻠَﺎﻡُ ﻋَﻠَﻴْﻚَ ﻳَﺎ ﻣَﻦْ ﺯَﻳَّﻨَﻪُ ﺍﻟﻠّٰﻪُ،
ﺍَﻟﺼَّﻠَﺎﺓُ ﻭَﺍﻟﺴَّﻠَﺎﻡُ ﻋَﻠَﻴْﻚَ ﻳَﺎ ﻣَﻦْ ﺷَﺮَّﻓَﻪُ ﺍﻟﻠّٰﻪُ،
ﺍَﻟﺼَّﻠَﺎﺓُ ﻭَﺍﻟﺴَّﻠَﺎﻡُ ﻋَﻠَﻴْﻚَ ﻳَﺎ ﻣَﻦْ ﻛَﺮَّﻣَﻪُ ﺍﻟﻠّٰﻪُ،
ﺍَﻟﺼَّﻠَﺎﺓُ ﻭَﺍﻟﺴَّﻠَﺎﻡُ ﻋَﻠَﻴْﻚَ ﻳَﺎ ﻣَﻦْ ﻋَﺰَّﻣَﻪُ ﺍﻟﻠّٰﻪُ،
ﺍَﻟﺼَّﻠَﺎﺓُ ﻭَﺍﻟﺴَّﻠَﺎﻡُ ﻋَﻠَﻴْﻚَ ﻳَﺎ ﻣَﻦْ ﻋَﻠَّﻤَﻪُ ﺍﻟﻠّٰﻪُ،
ﺍَﻟﺼَّﻠَﺎﺓُ ﻭَﺍﻟﺴَّﻠَﺎﻡُ ﻋَﻠَﻴْﻚَ ﻳَﺎ ﻣَﻦْ ﺳَﻠَّﻤَﻪُ ﺍﻟﻠّٰﻪُ،
ﺍَﻟﺼَّﻠَﺎﺓُ ﻭَﺍﻟﺴَّﻠَﺎﻡُ ﻋَﻠَﻴْﻚَ ﻳَﺎ ﻣَﻦِ ﺍِﺧْﺘَﺎﺭَﻩُ ﺍﻟﻠّٰﻪُ،
ﺍَﻟﺼَّﻠَﺎﺓُ ﻭَﺍﻟﺴَّﻠَﺎﻡُ ﻋَﻠَﻴْﻚَ ﻳَﺎ ﺳَﻴِّﺪَ ﺍْﻻَﻭَّﻟﻴﻦَ ﻭَﺍْﻻٰﺧِﺮﻳﻦَ،
ﺍَﻟﺼَّﻠَﺎﺓُ ﻭَﺍﻟﺴَّﻠَﺎﻡُ ﻋَﻠَﻴْﻚَ ﻳَﺎ ﺷَﻔﻴﻊَ ﺍﻟْﻤُﺬْﻧِﺒِﻴﻦَ،
ﺍَﻟﺼَّﻠَﺎﺓُ ﻭَﺍﻟﺴَّﻠَﺎﻡُ ﻋَﻠَﻴْﻚَ ﻳَﺎ ﺧَﺎﺗَﻢَ ﺍﻟﻨَّﺒِﻴﻴﻦَ،
ﺍَﻟﺼَّﻠَﺎﺓُ ﻭَﺍﻟﺴَّﻠَﺎﻡُ ﻋَﻠَﻴْﻚَ ﻳَﺎ ﺭَﺣْﻤَﺔً ﻟِﻠْﻌَﺎﻟَﻤﻴﻦَ،
ﺍَﻟﺼَّﻠَﺎﺓُ ﻭَﺍﻟﺴَّﻠَﺎﻣُﻪ ﻋَﻠَﻴْﻚَ ﻳَﺎ ﺍِﻣَﺎﻡَ ﺍﻟْﻤُﺘَّﻘِﻴﻦَ،
ﺍَﻟﺼَّﻠَﺎﺓُ ﻭَﺍﻟﺴَّﻠَﺎﻡُ ﻋَﻠَﻴْﻚَ ﻳَﺎ ﺭَﺳُﻮﻝَ ﺭَﺏِّ ﺍﻟْﻌَﺎﻟَﻴﻦَ،
ﺀﺻَﻠَﺎﻭَﺍﺕُ ﺍﻟﻠّٰﻪِ ﻭَﻣَﻼَﺋِﻜَﺘِﻪِ ﻭَﺍَﻧْﺒِﻴَﺎﺋِﻪِ ﻭَﺭُﺳُﻠِﻪِ ﻭَﺣَﻤَﻠَﺔِ
ﻋَﺮْﺷِﻪِ ﻭَﺟَﻤﻴﻊِ ﺧَﻠْﻘِﻪِ ﻋَﻠٰﻰ ﺳَﻴِّﺪِﻧَﺎ ﻣُﺤَﻤَّﺪٍ ﻭَﻋَﻠٰﻰ ﺍٰﻟِﻪِ
ﻭَﺻَﺤْﺒِﻪِ ﺍَﺟْﻤَﻌﻴﻦَ
ﺍﻟﻠﻬﻢ ﺻﻞ ﻋﻠﻲ ﺳﻴﺪﻧﺎ ﻣﺤﻤﺪ ﻭ ﺁﺩﻡ ﻭ ﻧﻮﺡ ﻭ ﺇﺑﺮﺍﻫﻴﻢ ﻭ
ﻣﻮﺳﻲ ﻭ ﻋﻴﺴﻲ ﻭ ﻣﺎ ﺑﻴﻨﻬﻢ ﻣﻦ ﺍﻟﻨﺒﻴﻴﻦ ﻭ ﺍﻟﻤﺮﺳﻠﻴﻦ
ﺻﻠﻮﺍﺕ ﺍﻟﻠﻪ ﻭ ﺳﻼﻣﻪ ﻋﻠﻴﻬﻢ ﻋﻠﻴﻬﻢ ﺍﺟﻤﻌﻴﻦ

Click on this picture to go to my Marriage Bureau!
husbandandwife.jpg
http://emeraldmountain.tripod.com/muslimmarriageforyou/

yamalikulmulk.jpg

The wonderful hands of the Holy Prophet (SallAllahu alaihi wa sallim)

Allah Ta'ala has sent His Prophets with miracles and clear signs and the personality of the Holy Prophet (Sallallahu alaihi wa sallam) is nothing but a miracle.  From His blessed body, the signs of the Power of Allah Ta'ala are made manifest and innumerable signs of the Lord's power were revealed.

The blessed hands of the Holy Prophet (Sallallahu alaihi wa sallam) 

When the Holy Prophet (Sallallahu alaihi wa sallam) took the pledge from the Sahabah, Allah Ta'ala revealed the following verse and declared the Prophet’s hand as His own hand.

“…the Hand of Allah is over their hands…” Surah Fath (48:10) 

Hadhrat Yazid bin Aswad (May Allah be well pleased with him) narrates about the hand of the Holy Prophet (Sallallahu alaihi wa sallam): I had the good fortune of meeting the Holy Prophet (Sallallahu alaihi wa sallam), I found that the His hand was cooler than ice and more fragrant than musk.  (Zurqani ‘Al’al Mawahib Vol. 5, Pg No: 453)

Hadhrat Abu Juhaifah (May Allah be well pleased with him) says: People would kiss His hands and rub them on their faces to gain blessings.  I also took His hand and placed it on my face.  I found that it was cooler than ice and more fragrant than musk. (Sahih Bukhari Vol. 1, Pg No: 502)

His hands' miraculous attribute was that wherever He (Sallallahu alaihi wa sallam) would place it, that place would be blessed forever.  The blessings of His hand would heal diseases; remove troubles; dry udders of a goat would overflow with milk and streams of water would run forth from His fingers.  A wave of His hand would split the moon into 2 and the set sun would return.

Hadhrat Ibn Amr (May Allah be well pleased with him) narrates:  In the Battle of Hunayn, an arrow got stuck in my forehead and because of it, blood kept flowing on my head and chest.  The Holy Prophet (Sallallahu alaihi wa sallam) wiped the blood off my face and chest with His hands and prayed for me.  The blessing of His hand was such that the area He touched became bright and radiant. (Seerat Halbiya Vol. 2, Pg No: 128)

His fingers:

There are many Hadith in the various collections of Hadith, (like Sunan, Musnad, Majma, Musnad, etc.) a number of Hadith are recorded which clearly mention that streams of water issued forth from the fingers of the Holy Prophet (Sallallahu alaihi wa sallam) and the thirst of the Sahabah who were present at that time was quenched.

Here the Hadith of Sahih Bukhari is being related.

Translation of Hadith:  It has been narrated on the authority of Hadhrat Abdullah Bin Mas'ud (May Allah be well pleased with him), he said:  We would consider miracles as blessings and you consider them a means to frighten with!  We were in a journey along with the Holy Prophet (Sallallahu alaihi wa sallam).  Water had run scarce.  The Holy Prophet (Sallallahu alaihi wa sallam) ordered:  Bring some water.  The Sahabah brought a vessel with little water in it.  The Holy Prophet (Sallallahu alaihi wa sallam) placed His blessed hands in it and said:  Come towards the water, which purifies, the water which has blessings.  The blessings (Barakah) is from Allah Ta'ala.  Hadhrat Abdullah Bin Mas'ud (May Allah be well pleased with him) says:  Water is issuing forth from between the fingers of the Holy Prophet (Sallallahu alaihi wa sallam) and when the Holy Prophet (Sallallahu alaihi wa sallam) would eat, we would hear the Tasbeeh (of the food).  (Sahih Bukhari, Hadith No. 3579)

This miracle has been expressed many times, in journey and out of it.  Among the Sahabah who have narrated this are Hadhrat Anas, Hadhrat Jabir Bin Abdullah, Hadhrat Abu Saeed Khudri, Hadhrat Aisha Siddiqua, Hadhrat Abdullah Bin Abbas (May Allah be well pleased with them) and many others.

There is a Hadith narrated on the authority of Hadhrat Anas (May Allah be well pleased with him) in Sahih Bukhari:

Hadhrat Anas (May Allah be well pleased with him) narrates:  When the Holy Prophet (Sallallahu alaihi wa sallam) was in Zaura, a vessel was brought to Him. When He (Sallallahu alaihi wa sallam) kept His hand in it, water started flooding out of His fingers.  The Sahabah performed their ablutions with that water.  Hadhrat Qatadah (May Allah be well pleased with him) says: I asked Anas (May Allah be well pleased with him) as to how many Sahabah were there? He replied, “300 or around 300.  Hadhrat Qatadah (May Allah be well pleased with him) says:  I asked Hadhrat Anas (May Allah be well pleased with him), what was your number.  He said:  300 or near to it.  (Sahih Bukhari, Hadith No. 3572)

There is a Hadith in Sahih Bukhari narrated on the authority of Hadhrat Jabir (May Allah be well pleased with him) as well.

Translation of Hadith:  Water started issuing forth from His blessed fingers like streams welling up.  Hadhrat Jabir (May Allah be well pleased with him) says:  We all quenched our thirst and performed Wuzu.

Hadhrat Jabir (May Allah be well pleased with him) says:  On the day of Hudaibiyah, the Sahabah felt very thirsty.  A vessel was placed in front of the Holy Prophet (Sallallahu alaihi wa sallam).  He (Sallallahu alaihi wa sallam) performed Wuzu with it.  The Sahabah came to Him.  The Holy Prophet (Sallallahu alaihi wa sallam) asked: What is the matter with you?  The Sahabah said: O Prophet of Allah (Sallallahu alaihi wa sallam) except the water in your vessel, there is nothing for us to perform Wuzu with or to drink.  The Holy Prophet (Sallallahu alaihi wa sallam) kept His hand in the vessel.  Water started flooding out from His fingers like a stream.  Hadhrat Jabir (May Allah be well pleased with him) says: Then all of us drank from it and performed Wuzu with it.  The narrator Hadhrat Salem (May Allah be well pleased with him) says:  I asked Hadhrat Jabir (May Allah be well pleased with him), how many were you?  He said:  It would have surely sufficed even if were a lakh, we were 1500.  (Sahih Bukhari, Hadith No. 4152)

The interpreter of Sahih Bukhari, Hadhrat Hafidh Ibn Hajar Asqalani (May Allah shower His mercy on him) writes in the interpretation of this Hadith, on the authority of Qazi Iyaz (May Allah shower His mercy on him):

Translation:  The miracle of water issuing from the blessed fingers has been narrated by many Successors (Tab'ieen) on the authority of the Sahabah with unbroken chains of narration and from them reliable and authoritative Muhadditheen (Hadith experts).  This miracle has been expressed at many places in the presence of a large number of Sahabah and its denial by anyone is not proven at all and this is among those miracles which are established beyond doubt.

His generosity

The Prophet of Allah (Sallallahu alaihi wa sallam) is extremely generous.  He (Sallallahu alaihi wa sallam) would never let down any person because Allah Ta'ala has placed the keys of all the treasures in His hand and He (Sallallahu alaihi wa sallam) is the Disseminator and the holder of the treasures and Allah is the One who gives.  Nobody would come back empty-handed from His door.  The Lord Almighty says:

"Therefore treat not the orphan with harshness " Surah Dhuha (93:09)

His benevolence was such that the one who asks would get over and above what he/she wanted. Hadhrat Anas (May Allah be well pleased with him) says:  Whatever He (Sallallahu alaihi wa sallam) was asked, He gave.  Once the Holy Prophet (Sallallahu alaihi wa sallam) gave a person all the goats of a valley.  That person went back and announced in his tribe: O people, embrace Islam, Hadhrat Muhammad (Sallallahu alaihi wa sallam) grants so much that there is no danger of starvation. (Sahih Muslim Vol. 2, Pg No: 253)

Liwa Al Hamd

The flag of praise i.e. Liwa Al Hamd will be in the hands of the Holy Prophet (Sallallahu alaihi wa sallam).  Hadhrat Adam (Peace be upon him) and the entire creation will be under that flag:  And the flag of praise will be in my hand and I am not proud because of it.  Prophet Adam (Peace be upon him) and along with him every Prophet will be under my flag.  (Zujajatul Masabeeh, Vol. 5, Pg No: 15).

Keys of Jannah

Jame' Tirmidhi and Sunan Darmi, both have a Hadith:  The Holy Prophet (Sallallahu alaihi wa sallam) said:  On that day honor and the keys of heaven will be in my hand.  (Sunan Darmi, Muqaddima, Pg No: 24; Zujajatul Masabeeh, Vol. 5, Pg No: 14)

The keys to Jannah will be in the hands of the Holy Prophet (Sallallahu alaihi wa sallam) and He (Sallallahu alaihi wa sallam) will be the first one to knock at the doors of Jannah.  There is Hadith: And I will be the first one to get the doors of heaven opened.  (Sahih Muslim, Vol. 1, Pg No: 112; Zujajatul Masabeeh Vol. 5, Pg No: 18)

purpleshadeofyathrib.jpg

taweez.jpg

grandadrahmuthallahalaih.jpg

darood-e-tanjeena.jpg

There is nothing wrong with marking a grave with a stone or a piece of wood. There is nothing wrong with a man marking a grave so that he will know where it is. The Prophet (peace and blessings of Allaah be upon him) marked the grave of Uthmaan ibn Mazoon. Al-Mughni, 2/191 1 .Graves are not to be levelled to ground,because Prophet(peace be upon him) marked the grave of his companion with a HUGE stone. 2. The grave was so "HIGH" that the children made it as a reference to measure the highest jump(leap).

iaddedthecolorstothisgravestone.jpg

Imamay Adhamia Hadruth Abu Hanifa RahmuthALLAH Alaih informed us from Hammad that Ibrahim R.A said: Someone informed me that they had seen the grave of Prophet (Peace be upon him), the grave of Abu Bakr (ra), and the grave of Umar (ra) with "mounds on top of them protruding prominently from the ground" & on them pieces of white clay. Imam Muhammad said: We (Ahnaaf) adhere to this, the grave is marked with a prominent mound, but it is not to be made in the form of a square and that is the "Verdict of Abu Hanifa" [Kitab ulAthaar, Page No. 145, Published by Turath Publishing]

ReciteFatihaforthefatherofmankind
aadamalaihsalaam.jpg
http://www.abaychal.com/2013/10/footprint-of-hazrat-adam-as-in-sri-lanka.html

                                      Recite Fatiha upon our Father, who made a mistake in Heaven, and landed on top of this Mountain in Sri Lanka,
 
 May ALLAH Forgive him and us, Ameen!!!
Click on this link, to hear from Shaykh Kabbani about the Creation of Hadruth Aadam Alaih Salaat wa Salaam!: https://www.youtube.com/watch?v=666BAmYUMrU
Aadaamee joh kahta hai, Aadaamee joh Sontah hay!
 

shaykkabbaniiwearinganawesomerobemashallah.jpg

ihopethekalimahiswrittenonme.jpg

awesomeayats.jpg

flowersaremadebeutifullbyallahthemostbeautifullofall.jpg

Salaatun-Tu-naajeena can prevent Calamities, such as a plane from crashing or a ship from sinking, Read it daily! inshALLAH

http://www.youtube.com/watch?v=7FDX-lnBnzk
duafromhadith.jpg
Make it a habit to make ZICKER of ALLAH, everyday and night!, inshALLAH

 

Illuminati Hypersexualization of Children Exposed! Disney Pedophilia and Satanic Rolemodels - Duration: 38:38.

by codenameANOOR

https://www.youtube.com/watch?v=IpYkKeXdZD0

 

https://www.youtube.com/watch?v=hwUwchCeeI4

Let the Liberals know that Child Marriage may be the better Alternative to the Abortions they are planning!

 http://www.mississauga.com/news-story/5735932-video-anti-abortion-groups-refuse-to-stop-delivering-graphic-flyers-targeting-justin-trudeau/

http://www.zawaj.com/articles/abortion_permitted_when.htmlrtion!

 

DOUBLE IMPACT 2 NAY ABEE, DAKE-AH NAHEE, DAKE-AH HAY TO JAANAH NAHEEE, JAANAH HAY TO PACHANA NAHEE!

riseoftheveiled.jpg

Dua for asking Forgiveness & Mercy from Allah:

رَبَّنَا ظَلَمْنَا أَنفُسَنَا وَإِن لَّمْ تَغْفِرْ لَنَا وَتَرْحَمْنَا لَنَكُونَنَّ مِنَ الْخَاسِرِينَ

Transliteration:...
Rabbanā Zalamna anfusana wa'illum taghfir lana wa'tar-hamna lana-koonan-na mi-nal khasireen.

Meaning:
Our Lord! We have wronged our own souls: If thou forgive us not and bestow not upon us Thy Mercy, we shall certainly be lost.

Reference:
~Holy Qur'an Surah Al-A'raf - 7:23

Remark:
Sayyidina Adam (Alaih Salaam) & Sadatheena Ummah Hawwa (Alaih Salaama) asked forgiveness from Allah (Subhaanahu Wata'ala) by reciting this Dua.

Read the Dua below when you hear THUNDER:
 Subhaanal-lathee yusabbihur-RAA'dU bee-hamdihee walmalaa'ikatu min khaayfathihee.
Translation:
Glory is to Him Whom thunder and angels glorify due to fear of Him.
سُبْـحانَ الّذي يُسَبِّـحُ الـرَّعْدُ بِحَمْـدِهِ، وَالملائِكـةُ مِنْ خيـفَته...

Whenever Abdullah bin Zubair (RA) would hear thunder, he would abandon all conversation and say this supplication. See Al-Muwatta' 2/992. It was graded authentic by Al-Albani as a statement of Abdullah bin Zubayr only.

idreeseetaheel.jpg

thisismyyoungerversionin1993-94.jpg

Click on this photo to hear a beautifull Song
doesarianahaveamuslimtwin.jpg
Maulid with Shakh Kabbani in Sri Lanka

Dil Lugraahay Kissee Ajnabee Say

tahajjuddua.jpg

ramadanmubarakfrombaghdad.jpg
http://www.youtube.com/watch?v=rMUYaQc3BAg&feature=share

niceislamiccallighraphy.jpg

ghauthalazmasdargahlookingbeautifull.jpg

http://aydnajimudeen.wordpress.com/sufism-biographies-hazrat-ghause-saqalain-sayyid-abdul-qaadir-r-a/

nabiorali.jpg

beautifulsayingofmaulahalimushkilkhushah.jpg

maulaaliisthemasterofrumee.jpg

psx_20180105_232834.jpg

Imam Shafi'i Radi Allahu Anhu said that: "The shrine of Sayyidina Imaam Moosa Al Kaazim (Alayhis Salaam) is a great means of acceptance."

Sayyidina Imam Jaafar as-Saadiq Radi Allahu Anhu said: "From all of my children, the most exalted is ...
Moosa Kaazim. He is a pearl from amongst the pearls (treasures) of Allah."

The blessed Imaam was born on the 7th of Safar. He's the noble son of Imaam Jafar As Saadiq (Alayhis Salaam). He spent his 15 last years of his life in prison. He attained martyrdom on the 25th of Rajab through poisoning, and his body was mercilessly laid down on the bridge of Baghdaad. There is no day like Imaam Hussain (Alayhis Salaam), but there're no years like Imaam Moosa Ibn Jafar (Alayhis Salaam)

Our Humble Salutation To This Precious Gem Of Aal E Muhammad (Sallallahu Alaihi Wa Aalihi Wa Sallam

786
May ALLAH Give us all the opportunity to memorize at least 40 Hadiths before we die, like the ones I've listed below, inShALLAH 

Why Forty Hadith? Did you know…

The Prophet Muhammad, may Allah bless him and give him peace, said “Whosoever memorizes and preserves for my people forty hadith relating to their religion, Allah will resurrect him on the Day of Judgment in the company of jurists and religious scholars.” 

أخبرنا مروانُ بنُ محمدٍ عن سعيدِ بن عبدِالعزيزِ ،، قال: لما كانَ أيام الحرةِ، لم يؤدَّنْ في مسجدِ النبيِّ صلى الله عليه وسلّم ثلاثاً ولم يُقَمْ ولم يبرحْ سعيدُ بن المسيِّبِ من المسجِدِ، وكان لا يعرفُ وقتَ الصلاةِ إلاَّ بهمهمةٍ يَسْمَعُها من قبرِ النبيِّ صلى الله عليه وسلّم فذكَرَ معناهُ
 .


#1.Translation: Sa’eed bin Abdul Aziz (rah) narrates: During the incident of Al-Harra, there was no Adhaan or Iqamah proclaimed from Masjid an Nabi (Peace be upon him) for “3 Days” Saeed bin Musayb (rah) stayed in the Mosque, “HE USED TO FIND OUT ABOUT TIME OF PRAYER BY THE WHISPERING VOICE WHICH HE HEARD FROM INSIDE THE GRAVE OF PROPHET (PEACE BE UPON HIM) 
[Sunnan al Darimi, Volume No.1, Page No. 44, Hadith # 94, Published by Dar ul Kutb al-iLmiyyah, Beirut, Lebanon]

وعن أبي هريرة قال: سمعت رسول الله صلى الله عليه وسلّم يقول: والّذي نَفْسُ أَبي القاسِمِ بِيَدِهِ لَيَنْزِلَنَّ عيسى ابنُ مَريمَ إمَاماً مُقْسِطاً، وَحَكَماً عَدْلاً، فَلَيَكْسِرَنَّ الصَّلِيْبَ، وَيَقْتُلَنَّ الخِنْزِيرَ، وَلَيُصْلِحَنَّ ذَاتَ البَيْنِ، وَلَيُذْهِبَنَّ الشَّحْنَاءَ، وَلَيَعْرُضَنَّ المَالَ فَلا يَقْبَلهُ أَحَدٌ، ثُمَّ لَئِنْ قَامَ على قَبْرِي فَقَالَ: يَا مُحَمَّدُ لأجِيْبَنَّهُ . قلت: هو في الصحيح باختصار. رواه أبو يعلى ورجاله رجال الصحيح

#2.Translation: Narrated Abu Hurayra I heard the Prophet say: "By the one in Whose hand is Abu al-Qasim's soul, `Isa ibn Maryam shall descend as a just and wise ruler. He shall destroy the cross, slay the swine, eradicate discord and grudges, and money shall be offered to him but he will not accept it. “THEN HE SHALL STAND AT MY GRAVESIDE AND SAY: YA MUHAMMAD! AND I WILL ANSWER HIM” 
(Abu Ya`la relates it with a sound (sahih) chain in his Musnad Volume No. 11, Page No. 462] 
 
#3.Imam Jalal Uddin Suyuti RahmuthALLAH Alaih, narrates in Al-Kassa-is-ul-Qubra and many other Islamic authorities reported in their books that “The great Caliph Umar Farooq alaih Salaam, Radee-Allahu Anhu, KarmALLAHu Wajhoo narrates that “Once, a very old man came to meet the Holy Prophet (SallALLAHwalaheewa Salim), when he (S.A.W) was staying in Makkah. The Old man was speaking the language of Jinns (angels), Our Holy Nabee (S.A.W) asked him “which tribe of Jinns you belong to?”, he replied “I am the grandson of Iblees (Satan).”  Our Holy Nabee (peace be upon him) asked “tell me your origin”, he replied ”I am Haam, the son of Heem, the son of Lakhees, the son of Iblees (Shaytan, known in Chritianity as Satan).” When our Master and Commander SallALLAH Walahee wa Salim (pbuh) asked about his age, he replied saying “I saw Qabeel (son of Adam (as)) murdering Habeel (son of Adam (Alaih Salaam)); I was a kid at that time. I embraced Iman (the faith) of Ibraheem (Alaih Salaam) and saw his people throwing him (as) into the fire, I tried to extinguish that fire. Then, I embraced Iman (the faith) of Musah (Alaih Salaam) and he (as) taught me about the Towrath (Torah) .Finally, I embraced Iman (the faith) of Messiah Isa ibnay Mariam (Alaih Salaam) and he( Jesus) taught me about the Injeel.” He further said, “O Holy Prophet (pbuh), I have a message for you”.  Our Gracious Prophet replied “give me that message”, he said “Jesus (peace be upon him) said to me that “after my elevation (into the heavens), Hudruth Sayyideena RasoolALLAH HabeebALLAH - AHMUDAY MUJTABAH MUHAMMEDAY MUSTAFA SullALLAH Walhee Wa SAlim will come as the last Messenger of ALLAH Asavajal, to this world, you will be alive at that time and you will get a chance to meet him (pbuh). When you meet the King of all prophets who is the best of all of ALLAH's creation (pbuh), convey my SALAAMS (salutations) to him.” My Master, the  Holy Prophet (pbuh) felt very happy on hearing this from the Great Jinn - Haam and thanked almighty Allah Asavajal with tears of happiness, flowing from his lovely eyes, he (pbuh) said “Peace be on you and my brother EESAH (Jesus Christ) .” Then the Holy Prophet (pbuh) asked Haam “Do you want anything from me?” Haam said “O Prophet (pbuh) I want to embrace Islam on your hand, please teach me some chapters of holy Quran.” Holy Prophet taught him ten chapters of holy Quran.” After narrating this whole scenario, Hadruth Umar-e-Farooq alaih Salaam (ra) said ”after that day, we never saw him again.”

References
Qurtabi, Jamya Ahkaam-ul-Quran, Volume 16, Page 213
Qurtabi, Jamya Ahkaam-ul-Quran, Volume 19, Page 5
Raazi Tafseer-ul-Kabeer, Volume 28, Page 28
Siyuti, Al Khasais-ul-Kubra, Volume 1, Page 234
 
#4. It is reported that the door of the Holy Prophet’s Burial Chamber opened on its own, and a voice was heard from the blessed grave of the Holy Prophet Muhammad  SALLAHWALAHE WA ALIHEE WA SAHIBIHEE WA SALIM:  saying:

Adqelul Habeeba ilal Habeeb

wa innal Habeeba mushtaqul illal Habeeb

Bring my beloved to his beloved; bring my friend to his friend

For the Beloved is longing for his beloved

Hazrath Abu Bakr Sideeq KarmALLAHu Wajhu alaih Salaam  is fortunately buried within the Sacred Burial Chamber!

#5. The snake  that bit Hadruth Abu Bakur-nis Sideeq Radee-Allahu Anhu in the Thaur (Sideeqee Ghar-Cave) was a diciple of Hadhrat Musa Alayhissalam, you may ask, how did it get there?, well the answer is, it was when Hadhrat Musa Alaih Salaam was reading a passage from the Towrath which had some praises about the Holy Prophet Muhammad SallAllahu-wa-alayhee wa Sahibee waasallam and his ummah, so this diciple requested Hadhrat Musa Alaih Salaam to make a dua that "Ya Allah Please make this deciple of mine see the Most Ulitimate and Greatest Prophet to be born in the future to come" Hadhrat Musa Alaih salaam said, "I doubt it ,if the Dua will be accepted because it's nearly impossible, but He  made the Dua anyway. Allah Subaanahoo Talah, told Hadhrat Musa Alaih Salaam to tell his diciple to go in to this cave and in that hole and hide inside that hole, but the disciple replied: How can I do that? the hole is too small?  He was told that he would get turned into a snake!
 
#6.The Holy Prophet SallAllaho Alaihi wa Sallam once asked Hadrat Jibrael Alaihis Salam,

“O Jibrael! How old are you?”
Jibrael al-Ameen Alaihis Salam replied,
“O Rasoolullah SallAllaho Alaihi wa Sallam, I don’t know how old I am, but I do know that in the Fourth Covering (حجاب), I saw a star shine once every 70,000 years, and I saw this 72,000 times.”

The Holy Prophet SallAllaho Alaihi wa Sallam then said,

وعزة ربي انا ذلك الكوكب

“By the honour of Allah SubHanuhu wa Ta’ala! I was that Star.” [Tafseer Rooh al-Bayaan, Vol. 1, Page 974]

http://islamicbooks7.com/products/TAFSEER-ROOHUL-BAYAN--%252d--15-Volumes-,by-Allama-Ismail-Haqqi-alayhir-rahman.html

#7  SAHIH MUSLIM Book 031, Number 5915:        

This hadith has been narrated. on the authority of Shu'ba with the same chain of transmitters. Amir b. Sa'd b. Abi Waqqas reported on the authority of his father that Muawiya b. Abi Sufyin appointed Sa'd as the Governor and said: What prevents you from abusing Abu Turab (Hadrat 'Ali), whereupon be said: It is because of three things which I remember Allah's Messenger (may peace be upon him) having said about him that I would not abuse him and even if I find one of those three things for me, it would be more dear to me than the red camel's leg. I heard Allah's Messenger (may peace be upon him) say about 'Ali as he left behind hrin in one of his campaigns (that was Tabuk). Hadruth'Ali KarmAllahu Wajhu alaih Salaat wa Salaam, said to him: Allah's Messenger, you leave me behind along with women and children. Thereupon Allah's Messenger (may peace be upon him) said to him: Arn't you satisfied with being unto me what Aaron was unto Moses but with this exception that there is no prophethood after me. And I (also) heard him say on the Day of Khaibar: I would certainly give this standard to a person who loves Allah and his Messenger and Allah and his Messenger love him too. He (the narrator) said: We have been anxiously waiting for it, when he (the Holy Prophet) said: Call 'Ali. He was called and his eyes were inflamed. He applied saliva to his eyes and handed over the standard to him, and Allah gave him victory. (The third occasion is this) when the (following) verse was revealed:" Let us summon our children and your children." Allah's Messenger (may peace be upon him) called 'Ali, Faathima, Hasan and Husain and said: O Allah, they are my family.

Hadith #8. Abu Talib (May ALLAH be pleased with him if he REALLY Recited the Kalimah at the time of his death.) According to Ibn Ishaaq, the Father of Maula Ali KarmAllahu Wajhu did  recite the Kalima on his death Bed, Al-bayhaqi Also Declares:

& Ibn Ishaq says
that while dying Abu Talib’s lips were in motion. al-Abbas who was
till then a nonbeliever, put his ear to his Abu Talib's lips and then said to the

Prophet S.A.W that he was reciting the KALIMA the Prophet had wanted of him recite.

Ibn Hisham, Cairo Edition, p 146

Hadith # 9 Vinegar is the BEST curry:

http://www.deenislam.co.uk/food3.html

 http://www.globalrevolutionnetwork.com/this-is-how-to-make-your-own-organic-apple-cider-vinegar-at-home/

Juraij had got constructed a temple and confined himself in that. His mother came to him as he was busy in prayer and she said:
   Juraij.
He said:
   My Lord, my mother (is calling me while I am engaged in) my prayer. He continued with the prayer.

She returned and she came on the next day and he was busy in prayer, and she said:
   Juraij.
And he said:
   My Lord, my mother (is calling me while I am engaged) in prayer, and he continued with the prayer and she went back, and then on the next day she again came and he was busy in prayer and she said:
   Juraij.
And he said:
   My Lord, my mother (is calling me while I am engaged in my prayer, and he continued with the prayer,
and she said:
  My Lord, don't give him death unless he has seen the fate of the prostitutes.

The story of Juraij and that of his meditation and prayer gained currency amongst Bani Isra'il (Israelites). There was a prostitute who had been a beauty incarnate. She said (to the people):
  If you like I can allure him to evil.
She presented herself to him but he paid no heed (to her). She came to a shepherd who lived near the temple and she offered herself to him and he had a sexual intercourse with her and so she became pregnant and when she gave birth to a child she said:
  This is from Juraij.
So they came and asked him to get down and demolished the temple and began to beat him. He said:
  What is the matter?
They said:
  You have committed fornication with this prostitute and she has given birth to a child from your loins.
He said:
  Where is the child ?

They brought him (the child) and he said:
  just leave me so that I should observe prayer.
And he observed prayer and when he finished, he came to the child. He struck his stomach and said:
  O boy, who is your father?
The child said:
  He is such shepherd.
So they turned towards Juraij, kissed him and touched him (for seeking blessing) and said:
  We are prepared to construct your temple with gold.
He said. No, just rebuild it with mud as it had been, and they did that.
Taken from Sahih Muslim

#11. HaDith #2424 from tirmidhi, v4, P188, dar-ul-fikR

Rasul Allah (sal Allahu alaihi wa sallam) said, "The two feet of the son of Adam will not move from near his Lord on the Day of Judgement until he is asked about five (matters) concerning his life - how he spent it; about his youth - how he took care of it; about his wealth - how he earned it; and where he spent it; and about that which he acted upon from the knowledge he acquired." [Tirmidhi]

So there is no escape from being questioned about:

1. Your life - how you spent it. Was it in righteousness and piety or in sin and transgression?

2. Your youth - how you spent it. Was it in acts of obedience or acts of disobedience to Allah?

3. Your wealth - how you acquired it. Was it from that which is halaal or from that which is haraam?

4. Your wealth - how you spent it. Did you give others their rights in it - your relatives, the needy, the orphans, the mujahideen... or did you squander it on yourself alone?

5. Your knowledge - how you acted upon it. How much of your knowledge of Allah’s Deen did you put into practice? Did you study Islam to live by its teachings or did you acquire knowledge of the Quran and hadith to appear knowledgeable with it or gather wealth with it?

These things we seldom think about or question ourselves over. Allah (subhana wa ta’ala) has promised us our sustenance, but not promised us forgiveness. Yet we fret over the acquisition of wealth but not over acquiring Allah’s forgiveness. Doomed is the person who does not question himself, but waits to be questioned!

Hadith #12. It is said that Sayyiduna Massiyah Isa Alaih Salaam (Jesus Christ), once saw Satan with four loaded donkeys. Massiyah-Isa Alaih Salaam, asked him what they were carrying? Satan replied, They are carrying my merchandise, one of them is carrying cruelty, another is carrying dishonesty, the third is carrying treachery, and the last one is carrying jealousy. He Massiyah Isa alaih Salaam, asked, Who will buy this merchandise? Satan replied, Rulers will buy cruelty, traders will buy dishonesty,women will buy my treachery, and as far as the jealousy is concerned, scholars will buy that. (Nuzha-tul-Majalis, V2, P53,(Dar-ul-Kutubul Ilmiyyah Beirut)

judgmentday.jpg

Hadith#13. Our Savior, Master and Leader of all the Ambia wal Mursaleen Ramathil-lil-Alameen Hudrathun Nabee Muhammaday Mustafa SallAllahwalahee wa salim; said:
The Sirat Bridge will be set over Hell. The first prophet who will cross it with his nation will be I.
[Bukhaari]
Then a bridge will be laid over the (Hell) Fire. "I will be the first to cross it. And the invocation of the Apostles on that Day, will be:"Allahumma Sallimni, Sallimni" (O Allah, save us, save us!),& over that bridge there will be hooks Similar to the thorns of As Sa'dan (a thorny tree).
These hooks will snatch the people according to their deeds.
Some people will be ruined because of their evil deeds, and some will be cut into pieces and fall down to Hell, but will be saved afterwards, when Allah asavajal has finished the judgments among His slaves, and intends to take out of the Fire whoever He wishes to take out from among those who used to testify that none had the right to be worshipped but Allahu(AHADUSAMAD)(Sahih Bukhari)
On the Day of Resurrection I will stand by the side of the Sirat Bridge and wait for my nation to cross it. Allah ta'ala will say, "Ask for whatever you want. Intercede for whomever you wish, for your intercession will be accepted.
After interceding for my nation, I will continue entreating, and I will not rise to my feet until He ALLAH asasavajal says"Put all people into Paradise who said:La ilaha ill-Allah once with ikhlas and died with faith.)"[Ahmad]
Crossing the Sirat-depend's on one's internally pious saintly light.
Some will cross it in the twinkling of an eye; some, like lightning; some, like a falling star; some, like a running horse.
He who has very little light, will creep facedown. His hands and feet will slip, and he will cling to it again. At long last, he will break free from it by creeping and creeping.) [Tabari)

Hadith #14. Nafi' reported from 'Abdullah that Allah's Messenger (may peace be upon him) said: I was shown Hell, in which I saw a woman from Bani Israel being tortured, because in the world, she had kept a cat tied until it died of hunger, and (as a punishment of this offence) she will be thrown into the Hell. She didn't provide the cat with food, or drink, and hadn't freed it, so that it could eat the insects of the earth. (Sahih Muslim & Mishkat bishari Mirqat Hadith #5341 Darul-Fikr Beirut)

Hadith.#15 Abu Huraira radi allahu `anhu (may God have mercy on him) reported Allahs Messenger (peace be upon him) as saying: There was a dog moving around a well whom thirst would have killed. Suddenly a prostitute from the prostitutes of Bani Israil [Children of Israel] happened to see it and she drew water in her shoe and made it drink, and she was pardoned because of this. (Sahih Muslim, 2245 b)

Hadith.#16 is dedicated to the Imam of Masjid-Noorul Herum(Yunus): When a person speaks in the Masjid, an Angel on the first instance says O friend of Allah, keep quiet. On the second instance the Angel says O enemy of Allah, keep quiet and if the person persists, the Angel says May ALLAH'S curse be upon you!!!


Hadith # 15. Narrated Ursa:

Thuwaiba Radee-Allahu Anha Salaam AllahAlaiha was the freed slave girl of Abu Lahb whom he had manumitted, and then she suckled the Prophet. When Abu Lahb died, one of his relatives saw him in a dream in a very bad state and asked him, "What have you encountered?"

Abu Lahb said, "I have not found any rest since I left you, except that I have been given water to drink in this (the space between his thumb and other fingers) and that is because of my manumitting Thuwaiba."

[Bukhari: Volume 7, Book 62, (Book of Marriage kitab Al Nikah ) Number 38]

 

The hadith of Thuwaiba is in the Sahih of Imam Bukhari, Kitab-ul-Nikah who quotes this from his own Shaykh, Imam Abdul Razzaq who was the student of Imam e Aazam, Abu Hanifah (ra).

It is also quoted by Imam Ibn Asqalani in “Fath al bari”, Hafiz Ibn Katheer, Imam Bayhaqi, Imam Sohaili, Imam Baghawi, Imam Qurtubi, Imam Jawzi, Imam Mullah Ali Qari, and Imam Abdul Haq Muhaddith Delhvi (ra).

 

Firstly some critics have argued that,

since it is an Islamic principle that a pious act done by a kafir is not rewarded in the Hearafter how can Abu Lahab benefit?

 

Imam Razzaq discusses this subject in his “Musanaf” (vol 7 p. 478) as does Imam Abdul Haq Muhaddith Delhvi (ra). They state that this is the Khasais (Specilaity) of the Holy Prophet (sal Allahu alayhi wa sallam)) and an exception just reserved for him.

Hadith# 16 Explanation

Dressed but Naked

As one of the minor signs before the Day of Judgment, Rasul Allah (sal Allahu alaihi wa sallam) mentioned: “There will be women who will be dressed but they will be naked. Their heads will be like the humps of camels. They will not enter Jannah and will not even smell the scent of Jannah while it can be smelt from a far distance.” [Sahih Muslim] Another hadith mentions that one can smell the scent of Jannah from a distance traveled in seventy years.

This hadith is about Muslim women as those without eeman wouldn’t be entering Jannah anyway.  Muslim women will have clothes on but they will be so tight and figure hugging that all parts of their bodies will be on display. Today we see clothes marketed that are so tight that all they conceal is the color of the skin. This hadith also applies to very thin and see-through clothes. The head looking like the hump of a camel probably means some sort of hair style.

Rasul Allah (sal Allahu alaihi wa sallam) said: “Modesty brings nothing but good.” [Sahih Bukhari] Hazrat Uthman (radi Allahu anhu) was well known for his modesty. So much so that even the angels were mindful of it. Hazrat Fatima (radi Allahu anha) is also well known for her sense of haya and modesty.

yashayk.jpg

muaymubarakofghawthalazam.jpg

hazrathaliquotes.jpg

duaforforgiveness.jpg

 
            
"اللَّهُمَّ يا اللهُ يا لَطِيفُ صَلِّ على عَبْدِكَ و حَبِيبِكَ سَيِّدِنا مُحَمَّدٍ النَّبِيِّ اللَّطِيف و على آلِهِ و صَحْبِهِ و سَلِّمْ تَسْلِيماً و اجْرِ بِهِ يا رَبِّ لُطْفَكَ الخَفِيَّ في أُمُوري و أُمُورِ المُسْلِمي"
 
Allāhumma yā Allāhu yā Laṭīfu ṣalli `alā `abdika wa ḥabībika sayyidinā Muḥammad an-Nabī al-laṭīf wa `alā ālihi wa ṣaḥbihi wa sallim taslīman w’ajri bihi yā rabbi luṭfak al-...khafiya fī umūrī wa umūri’l-muslimīn.

O Allāh, O Gentle, bestow abundant prayers and peace upon Your slave and beloved, our Master Muḥammad, the gentle Prophet and upon his Family and Companions, and by him cause Your hidden gentleness to permeate my affairs and the affairs of all the Muslims.

[From Habib Umar’s BEAUTIFUL collection of weekly
 

For Du’aa’ al-Qunoot in Witr prayer a number of wordings have been narrated, including the following:

1 – The version which the Messenger of Allaah (peace and blessings of Allaah be upon him) taught to al-Hasan ibn ‘Ali (may Allaah be pleased with him), which is:

“Allaahumma ihdini feeman hadayta wa ‘aafini feeman ‘a...afayta wa tawallani feeman tawallayta wa baarik li feema a’tayta, wa qini sharra ma qadayta , fa innaka taqdi wa la yuqda ‘alayk, wa innahu laa yadhillu man waalayta wa laa ya’izzu man ‘aadayta, tabaarakta Rabbana wa ta’aalayta la munji minka illa ilayk

(O Allah, guide me among those whom You have guided, pardon me among those whom You have pardoned, turn to me in friendship among those on whom You have turned in friendship, and bless me in what You have bestowed, and save me from the evil of what You have decreed. For verily You decree and none can influence You; and he is not humiliated whom You have befriended, nor is he honoured who is Your enemy. Blessed are You, O Lord, and Exalted. There is no place of safety from You except with You).” 

 

Prayer 3/3 from the #GlimpsesIhya Class for Aiding Against Ostentation (Riya)

This prayer is attributed to Imam Ali Zain al-Abidin, son of al-Hussein, upon them both be peace. The first part of it is attributed to his grandfather, Imam Ali:

اللَّهُمَّ إنِّي أعُوذُ بِكَ أنْ تَحْسُنَ فِي لَامِعَةِ الْعُيُونِ عَلَانِيَتِي وَتَقْبُحَ لَكَ فِيمَا أخْلُو سَرِيرَتِي، مُحَافِظًا عَلَى رِيَاءِ النَّاسِ م...
ِن نَفْسِي مُضَيِّعًا لِمَا أنْتَ مُطَّلِعٌ عَلَيهِ مِنِّي، أُبْدِي لِلنَّاسِ أحْسَنَ أمْرِي وَأُفْضِي إلَيكَ بِأسْوَأ عَمَلِي، تَقَرُّبًا إلَى النَّاسِ بِحَسَنَاتِي
وَفِرَارًا مِنْهُم إلَيكَ بِسَيِّآتِي، فَيَحِلَّ بِي مَقْتُكَ وَيَجِبُ عَلَيَّ غَضَبُكَ، أعِذْنِي مِنْ ذَلِكَ يَا رَبَّ الْعَالَمِين

Allahuma inni a’udhu bika an tahsuna fi lam’iatil ‘uyuni ‘alaniyati wa taqbaha laka fi-ma akhlu sarirati, muhafidhan ‘ala riya an-naasi min nafsi, mudayi’an lima anta mutali’an alayhi mini, ubdi lin-nasi ahsana amri wa ufdi ilayka bi-aswa amali, taqarubun ilan-nasi bi-hasanati
wa firaran minhum ilayka bi-sayi’ati, fa-yahilu bi maqtuka wa yajib ‘alaya gadabuka, a’idhni min dhalika ya Rabb al-alamin.

“O Allah, I seek refuge from my outward being beautified in the eyes of people and my inward being reprehensible to you; from being concerned for what people see in me while having totally lost sight of what You know of me; showing people the best I have to offer and presenting you with the worst of my deeds; drawing near to people with my good deeds and fleeing from them to you with my misdeeds, thus making me the object of your scorn and worthy of Your wrath. Give me refuge from this O Lord of the worlds."

The Prophet SullALLAHwalahee wa Salim would supplicate with this prayer:

ُاللَّهُمَّ إنِّي أعُوذُ بِكَ أنْ أشْرِكَ بِكَ شَيئًا أعْلَمُهُ وَأسْتَغْفِرُكَ مِمَّا لَا أعْلَمُه

Allahuma inni a’udhu bike an ushrika bika shayan a’alamuhu wa astagfiruka mima la a’alamuhu

O Allah I seek refuge in You from associating a partner with You knowingly, and I seek your forgiveness from what I do unknowingly.

 
 
As a practicing Muslim deeply influenced by tenets of my faith, I strongly condemn the brutal atrocities of the ISIS terrorist group. Their actions are a disgrace to the faith they proclaim and are crimes against humanity. Religion provides a foundation upon which to establish peace, human rights, freedoms and the rule of law. Any interpretations to the contrary, including the abuse of religion to fuel conflicts, are simply wrong and deceitful.
 
ISIS is not the first group to use religious rhetoric to mask its cruelty-Al Qaeda did so 13 years ago and Boko Haram more recently. What they all have in common is a totalitarian mentality that denies human beings their dignity.
 
Any form of violence against innocent civilians or prosecution of minorities contradicts the principles of the Qur’an and the traditions of our Prophet (upon whom be peace and blessings). ISIS members are either completely ignorant about the faith they proclaim or their actions are designed to serve individual interests or those of their political masters. Regardless, their actions represent those of a terrorist group and, as such, they should be brought to justice and compelled to answer for their horrific crimes.
 
I send my heartfelt condolences to the families of the deceased in Iraq and Syria, and to the families of James Foley, Steven Sotloff, and David Haines. May God give them strength, patience and perseverance, and alleviate their suffering. I also pray for the immediate and safe release of hostages and ask God, the Merciful, to lead us all toward mutual respect and peace. I invite everyone around the world to join me in these prayers.
 
Fethullah Gulen
Islamic scholar, preacher and social advocate
 
 
Sign Online Petitions to STOP Genocide in Burma

Please sign this petition to be sent to:
- Canada Minister of Foreign Affairs, John Baird
- 14th Dalai Lama, Dharamsala, India
- Aung San Suu Kyi, Leader of Opposition Party, Burma
 
 

The next Dalai Lama could be a woman ... but she'd have to be attractive.

Like, really attractive.

His Holiness made that assertion in an interview with BBC journalist Clive Myrie that was posted online Monday.

 https://www.youtube.com/results?search_query=burma+genocide+2015                                    

 
 
 

islam design 10 by mo123
verseregardingalaihbait.jpg

myoldbuddyrashidalbahraini.jpg

I'm extremely grateful to ALLAH asavajal for appointing a great buddy, like the heir of Khulafie-A-Rashideen: Rashid Al-Bahraini, Shaykh Yassir Yamani, and his Excellency  Abdou Muhammad Yamani for assisting me in Cairo, Egypt in 1998.  
 
 May ALLAH reward the Shayook and shower the utmost blessings on their holy spirits and upon grave of ABDOU MUHAMMAD YAMANI RAHMUTHALLAH ALAIH, AMEEN
 
Please recite Humd, Salawat and Fatiha combined with surah Ihkals, at least 3 times for our souls and theirs, AMEEN
 

miludunabbeejashinphoto.jpg

meanduncleabbass.jpg

http://www.youtube.com/watch?v=cHf-kSh1Y6w&feature=share

 
 

 

DEAR MUSLIMS AND NON-MUSLIMS IN OUR PLANET OF ISLAM, TRY YOUR BEST TO FULLFILL YOUR DAILY TRUST COMMITED TO HUMAN CARE BY THE MASTER OF THE ENTIRE CREATION AND EVERYTHING WITHIN, ALLAH JALAH JAALAHU’S  SACRED PILLAR OF ISLAM “SALAAT”(NAMAAZ)
By a talib of Ilm seeking more Roohaaniyat and more Qurb, to ALLAH asavajal and a Man that wants to follow in the footsteps of our Beautifully Blessed Sultaan of Prophets and Awlia-Allah, MuhammeduRasoolAllah SalAllah walay wa Salim, Yours truly the one and only, Syed Saifuddin Ali Khan Al Qadiri Al Jilaani Al Hasani, A Lover of the Lovers of ALLAH, and a Na-eeb Servant of ALLAH and His last final Prophet MuhammeduRasoolAllah (S.A.W)

All Praise, Glory, Thanks and Honor is due to ALLAH asavajal who created us in the best of fortunate human molds by putting us in the Ummuth of his HabeebAllah, NabiAllah, Nooramin-NoorAllah,KhairaKhalqillah, leader of all the Prophets, the Truthful, the Martyrs, and the Righteous MuhammeduRasoolAllah SalAllah walayhi wa salim, and gave us the mighty gift of Life, a blessing known as “Salaat”, to grant all our desires and to save us from the fires whose fuel is men and stones, InShallahutalah, by the Mercy of our lord, Allah Subhaanahu talah.

          Our Great and Glolorious Rab, Allah asavajal doesn’t insist so much on any other devotion as He does on the Obligatory 5 time Fard Salaat, at it’s proper times, we can gain additional benefits, from Nafil Salaat such as Salaatul Duha or known to Asians as Namaaz-e-Chast.

When the Sun has risen high and there is heat its rays, the performance of 2,4,6,8 or 12 Rakaats is called Salaatul Duha(Namaaz-e-Chast). This is full of Sawabs. The Hadith Traditions say that the performance of 2 Rakaats wipes away all ones sins. There are 360 joints in our body to pay Sadakah for each is wajib(Obligatory). The 2 Rakaats is enough to pay all the Sadakah. Performance of 4 Rakaats places the performer’s name among the Abids and is the Sunnat of Saliheen and promises the performer protection until the evening. The performer of 6 Rakaats is relieved of his day’s worries. Performance of 8 Rakaats places his name amongst the Righteous Abstainers (Parhezgaars) and the performer of 12 Rakaats ensures a Mansion made of Gold for himself in Jaanuth, (Paradise). (All those people that asked me to make Dua, I suggest you read 12 Rakaats Salaatul Doha, when you get the chance.)

Hazrath Sultaanil Hind Qutabal Masheik-e-Bahr-o-Bar Khaja Ghareebun Nawaaz Muinuddin Hasan Chisti Al Ajmeri, alaih Salaam has stated that, without performing Salaat, none can approach ALLAH, because Salaat is the climax in the process of such approach for the Pious, therefore Salaat is the ladder leading to the proximity of Allah asavajal. InShallahu talah wa la howla walah Quwutta Illa Billah.

Khaja Ghareebun Nawaaz QaddaSallahu wa Sirrahu wa Noorahu alaih Salaam, has also stated that

1.              Salaat is like a trust committed to human care by Allah asavajal and as such it should be zealously guarded

2.              Salaat is the climax or destination of the faithful

3.              Salaat is a secret relationship existing between the worshipper and the Worshipped. (Our Rabb, Master and King, ALLAH asavajal, glory be to HIM by the beauty of his Character and the Honor of all his names Asma-alHusna and the Ismul Azam, HE knows best and Loves dearly)

Khaja Ghareebun Nawaas RahmathAllah Alaih Salaam states that even the Malaa-eikah, (Angels) pray for him who, after performing Salatul Fajr remains sitting in Zikr of Allah Subhaanahu talah. (May ALLAH asavajal give us the Tawfiq and Time to do this act daily after our Salaats, InShalahutalah Ameen by the honor and Azmat of the Quranay Kareem.

Salaat is a crucial part of the Shariat, therefore by attaining the perfection of the Shariat, which is Islamic Law, one may reach the stage of Tariqat which is the path leading to Divinity, and then onward he may pass on to Maarifat, which is Enlightenment of the soul and lastly to Haaqiqat which is the Supreme state of Human Existence, InShalahutalah. By the will of Allah Subhaanaho –talah

Khaja Gareebun Nawaas RamathAllah Alaih Salaam said:One day my Murshsid Hazrath Usmaan Harooni R.A said, Tomorrow when the day of judgement will come, all Prophets, Saints, and Muslims will be interrogated by Allah asavajal about their responsibility to Salaat(Namaaz). Those that discharged this duty punctually will be spared but those that have not, or have been lazy, will be hurled in “Waile” which is a well in Hell, where the punishment is dreadful (Tafseer Imam Zahid).   Khaja Usmaan Harooni R.A, then himself explained the significance and meaning of the well named as “Waile”, Hazruth Khaja Usmaan Harooni R.A(Peace and blessings be upon him and may Allah asavajal guide me to a Murshid like him inShalahutalah) said “Waile” prayed to Allah to indicate the people for whom its torture was meant? The reply came: “This punishment is meant for those that don’t offer their prayers at the fixed times punctually.”(Aftaab-e-Ajmer, p.93-p.94)

When some people occupy themselves in worldly matters, they may feel Salaat is a burden, but for true Muslims, Salaat brings them peace and comfort.

RasoolAllah (S.A.W) said, “Salaat is the comfort of his eyes and wudu is the key to Salaat and Salaat is the key to Jannath.”

In a hadith found in Tirmizi it is stated that, “The person who observes Prayers will be honored by the Most Magnificent Lord in Five ways

1.    The scarcity of his means will be alleviated.

2.     He is exempted from the torments of the grave.

3.     On the Day of Qiyahmah the deed scroll will be handed over to him in his right hand.

4.    They shall pass over the bridge of heaven with lightning speed. 

5.    They shall be exempted from rendering accounts.

He, who shows reluctance in observing prayers, shall be tormented in 15 different ways.  Out of these he will feel 5 types of torments in the world, 3 types of torments at the time of death, 3 types of torments in the grave and 3 types of torments on arising from the grave.

   The worldly torments are the following firstly,

1.    his life is devoid of blessings.

Secondly,

2.    the glow that appears on the faces of the pure is removed from his face.

Thirdly,

3.    all the reward for his good deeds is cancelled,

Fourthly,

4.    his wishes are not granted.

Fifthly,

5.    he loses his right to be remembered by the pious in their prayers.

  The three torments at the time of death are these:

1.    Firstly, he dies in disgrace.

2.    Secondly, he dies in deprivation.

3.    Thirdly, he suffers from intense thirst at the moment of his death; and such is the intensity of his thirst that the whole sea can’t quench it.   

The three torments of the grave are as follows:

1.Firstly, the grave contracts around him so that his/or her breastbones break and pierce into each other.

2.Secondly, a fire is lit up in his grave.

3.Thirdly, a snake is sent to overpower him. The appearance of the snake is such that its eyes are like fireballs; its nails are made of iron and in length so big that their extremity could be reached only in a day’s journey. This snake bites his corpse and says, “I am the bare-headed snake.” Its voice is thunderous like lightning.

 After arising from the grave he will suffer the following three tortures:

1.    Firstly, he shall be severely called to account.

2.    Secondly, the wrath of the Most Just and Magnificent Lord Allah asavajal will be upon him.

3.    Thirdly, he shall be thrown into Jahannum. 4. Fourthly, Allah will entrust the person with an Angel who will draw the person on his face while other creatures watch the show and ALLAH asavajal will not look at that loser!

Therefore my dear friends and foes, I advise you to exercise Taqwa, meaning I want you to fear Allah asavajal and try to pay the debt you owe to Allah asavajal for all the favors he has bestowed upon us, especially the favor of our beloved Nabiyal Kareem Nabiyal Huda, Khairal Wara Muhammed (S.A.W) (May Allah asavajal Bless the Beauty of his Creation RasoolAllah SalAllah walayhi wa Salim, his Blessed Wives, his Pure Family, and his Righteous Friends as much as ALLAH's OWN BEAUTY combined with all the drops of Rain that fell upon the earth from the beginning of it's creation till the Yaumil Qiyaamah, InShAllahutalah, May ALLAH accept my Salawat by the Honor of ALLAH’s own Beauty and the Beauty of the Lohay Mafooz and all that it contains! AMEEN!

Allah asavajal had first prescribed 50 times obligatory Salaat, on lailatil Meraj, but due to the intercession and pleading of our blessed Nabi (S.A.W). Allah most gracious, reduced it to only 5 times a day, but he didn’t reduce the reward, (Then Which of the favors of your Lord will you Deny!!!)

           Like I’ve mentioned before, we can gain extra reward with additional Nafil salaat of our own free will. 2 or 4 rakaat of Ishraak Salaat after the sun has fully risen brings sawab equal to a Haj or Umrah. (Ref: Tirmizi Sharif)

A Hadith in Bayhaqi states that 4 rakats of Tahajjud is equal to 4 rakaats on Shabe-Qader, the performance brings one nearer to Allah, it’s Kaffara (payment) of ones previous sins and is prohibitive for the future sins. (Ref: Tirmizi Sharif).  Allah asavajal bestows his Rahmat on those that get up to read Tahajjud. (Ref: Abu Dawood, Nasai, and Ibn Habban).

 Hazrath Data Gunsh Baksh Ali bin Usman Al Jullabi Hujwiri RamathAllah Alaih asSalaam, states that praying “Salaat” involves certain preliminary conditions.

1.    Purification outwardly from filth and inwardly from lust;

2.    That one’s outward garment should be clean and one’s inner garment undefiled by anything unlawful;

3.    That the place that one purifies one’s self should be outwardly free from contamination and inwardly free from corruptness and sin

4.    Turning towards the Qibla, the outward Qibla being the Kabah and the inward Qibla being the throne of Allah asavajal, by which is meant the mystery of Divine contemplation

5.    Standing outwardly in the state of Qudrat (the power of nature) and inwardly in the state of Qurbat which is a garden of nearness to Allah asavajal

6.    Sincere intention to approach unto Allah rabbil Izzat

7.    Saying “ Allahu-Akbar” in the station of awe and annihilation, standing in the abode of union, and reciting the Quran distinctly and reverently, and bowing the head with humility, and prostating one’s self with abasement, and making the profession of faith with concentration, and saluting with annihilation of one’s attributes.

In Surah Baqarah verse 238, we are ordered to guard the prayers especially the middle prayer, Mehboobay Subhaani Warith-thul Rah-maani  Qutub-bay Rabbani Kunzulul Noorani Hadruth Juddee -Sayedina Abdul Qadir Jilani Qaddasallahu wa Sirrahu wa Noorahu alaih Salaat wa Salaam states, that the middle prayer is that of the heart and true worship is that of the heart, without true worship the ritual prayer is in disorder, the masjid for this prayer is the heart.  When the ritual worship of the inner being and the inner worship of the heart unite, the prayer is complete.

 References:

1.“Siral Asrar” The Secret of Secrets,

2. “Kashf al Mahjub”, The Oldest Persian Treatise on Sufi-ism,

3.The Holy Biography of Hazrat Khaja Muinuddin Chisti (RahmathAllah Alaih wa Salaam)

4. The Spectacle of Death including Glimpses of Life Beyond the Grave

5. The Life of Fatimah Az-Zahra The Principal of All Women

 by Allama Baqir Sharif Al-Qarashi Edit Text

 

  

 maulanarumeesblesshrine.jpg

 

maulanarumeesodeonsorrow.jpg

The story of Moses and the Shepherd from the Masnavi, vol 2:

Once Moses overheard a shepherd pray:

‘O God! O Lord!’ he heard this shepherd say,
‘Where do you live that I might serve you there?
I’d mend your battered shoes and comb your hair,
And wash your clothes , and kill the lice and fleas,
And serve you milk to sip from when you please;
I’d kiss your little hand, and rub your feet,
And sweep your bedroom clean and keep it neat;
I’d sacrifice my herd of goats for you
This loud commotion proves my love is true.’

He carried on in this deluded way,
So Moses asked, ‘What’s that I hear you say?’

‘I speak to my Creator there on high,
The one who also made the earth and sky.’

Moses replied, ‘You’ve truly lost your way;
You’ve given up the faith and gone astray.
It’s gibberish and babble, stupid twit
You’d better learn to put a cork in it!
Your blasphemy pollutes the atmosphere
And tears to shreds that silk of faith so sheer.
While socks and shoes might be superb for you,
How can they fit the sun? Have you a clue?
If you don’t shut your mouth immediately,
A fire will burn up all humanity!
You don’t believe? Then please explain this smoke,
And why your soul turned black when you just spoke!
If you’re aware that He is God, our Lord,
Why act familiar when that is abhorred?
Such stupid friendship’s truly enmity;
The Lord’s above such acts of piety.
For relatives reserve your generous deeds
God has no body, nor material needs:
Milk is for creatures who must drink and eat;
Shoes are for those who have a need for feet. ‘

Even when you address his chosen slave
Select your words with care, don’t misbehave,
Since God has said, “I’m he and he is I;
When I was ill you never once stopped by
He wasn’t left alone with his disease,
That servant who through me both hears and sees.
Don’t talk to saints without the reverence due!
It blocks your heart, and blots your record too.
If you address a man by Fatima’s name,
Though man and woman are inside the same,
He’ll still seek vengeance for it if he can,
Even if he’s a calm and patient man

That glorious name which women all revere
Can wound a man more deeply than a spear.
While hands and feet are great for you and me,
They’d just contaminate God’s purity
He was not born, nor does the Lord beget
But reproducing beings are in his debt.
Those with a body were once born, and must
Remain until death in this realm of dust;
That is because we wither and decay;
Unlike our Maker we must fade away.

The shepherd said, ‘Your words have struck me dumb,
Regret now burns my soul, and I feel numb.’
He breathed a heavy sigh and ripped his cloak,
Then in the desert disappeared like smoke.

God rebukes Moses for what he said to the shepherd
A revelation came down instantly:
‘You have just turned a slave away from me!
Was not to lead to union why you came?
Is causing separation now your aim?
As far as possible don’t separate
Above all else divorce is what I hate.
I’ve given each one his own special ways
And his unique expressions when he prays;
What he thinks virtuous you deem scandalous:
This person’s meat to you seems poisonous.
I stand immune to all impurity;
Men’s pride and cunning never bother me.
I don’t command for my own benefit,
But so my slaves themselves can gain from it.
For Indians their own dialect sounds best,
But folk from Sind, think theirs is the loveliest.
I’m not made any purer by their praise;
They gain in eloquence and godly ways.
And I pay no attention to their speech,
But their intentions and the heights they reach
I know when men’s hearts have humility,
Even if they should speak too haughtily. ‘

The heart’s the essence, words are mere effects:
The heart’s what matters, hot air He rejects.
I’m tired of fancy terms and metaphors;
I want a soul which burns so much it roars!
It’s time to light one’s heart with pure desire,
Burn thought and its expression with this fire!
How far apart the meek and well-behaved
From ardent lovers, who may seem depraved.
Each moment lovers burn themselves away;
A ruined village has no tithes to pay.
Don’t pick at faults and call him a disgrace,
Don’t wash the blood upon the martyr’s face!
It suits a martyr better that he bleeds,
And that’s worth more than countless pious deeds.

Men in the Ka’ba end the qibla rule
What use are boots, when swimming in a pool?
You don’t seek guidance from those drunken men,
So why insist they mend their rags again?
God’s lovers stand beyond all faiths, as they
Are shown by God Himself a higher way.
A gem which lacks a seal remains a gem;
Though sorrows rain down, love’s not changed by them.

A revelation comes to Moses, excusing the shepherd
Then in the depths of Moses, God concealed
Such secrets that can never be revealed;
Into his heart poured words, pure and refined,
Transparent just like speech and sight combined.

He lost his wits and then found them anew,
From pre- to post-eternity he flew.

If I describe this it will be in vain
What lies beyond words how can I explain?
This mystery would smash your brain to bits;
When writing it the firmest stylus splits.

Once Moses had heard God’s reproach, he ran
Towards the desert, searching for that man;
He followed footprints that the shepherd laid,
Scattering dust throughout the track he’d made.
Footprints of drunkards are a special kind,
Distinct from those the sober leave behind:
He starts just like a rook, steps straight ahead,
Then bishop-like diagonally instead,
Sometimes just like a wave’s crest rising high
And then as if a fish has slithered by;

Occasionally he’d write his thoughts in sand
Like fortune-tellers reading what is planned.
On reaching the poor shepherd finally,
Moses announced, ‘I bring you God’s decree:
Don’t bother with good manners anymore,
But let your heart express what’s in its core!
Your unbelief is faith, your faith God’s light;
The world, through you, is also safe and bright.
Absolved by God, Who does what He should will,
Speak out, and don’t be scared I blame you still!’

He said, ‘I passed that stage right at the start;
I’m drenched in blood now from my love-torn heart!
I’ve passed that lote tree found at heaven’s end;
A thousand spheres beyond, I still ascend.
You cracked the whip, which made my stallion vault
Above the heavens with a somersault!
May God stay close to human beings like me,
And may He bless your hand eternally!
With words my current state can’t be expressed;
What I have said give just a hint at best.’

The image in the mirror which you see
Is yours and not the mirror’s obviously;
The breath inside the reed a man has blown
Is not the reed’s, but that reed-player’s own.
Whenever you should praise God, be aware
It’s like this shepherd’s crazy-sounding prayer
Though yours seems better and more accurate,
Still, for the Lord, they’re both inadequate;
So when the veil is lifted don’t protest:
‘What’s now revealed we never could have guessed.’

The above extract was taken with permission from Rumi, The Masnavi: Book Two, tr. Juwid Mojaddedi, Oxford World’s Classics, Oxford University Press (for July 2007), vv. 1724-1800)
http://islamicamagazine.com/?p=772

All Praise is due to ALLAH-HU JALAH JALAALAHU- who gave me the opportunity to visit the Respected Tombs of Imamay Azam Abu Haneefa Rahmuth Allah-Alaih and Imam Shafeye Rahmuth Allah Alaih. 
 
I really wanted to visit Imam Ahmad bin Humbul Rahmuth Allah Alaih as well, I made an enquiry from a Iraqi, and was told, he's buried under a river, my greatest regrets in Iraq was not to visit his blessed Tomb which I now found out is at Martyr's cemetery, near the Harb gate of Baghdad. I also regret not to visit the Shrine of Sultanil Faqr Tajudeen Abu Bakr Abdur Razaaq  Kaylaani Gaylaani Jilaani AlHasani Alaih Salaat wa Salaam, who is also buried in the same cemetery as  Hadurth Ahmed bin Humbaal Alaih Salaat wa Salaam.
 
The Tomb of Sultanul Awlee-ah, Shah Ahmad Reefie-ee, Rahmuth-Allah-Alaih, is another place  which  I wish I had visited, it's South of Najafay Ashraf Shareef. 
 
 In my opinion the Humbali-Shafie -method performing Salatul Witr is the best!
 
Shaykh  Sibghatullah Rasool is in my opinion, among the World's  best Qarees of the Quranay Kareem,  from the same Kurdish origin as Imam Barzanjee Alaih Salaam and Sultan Salaahu-dean Aye-youbee Ramuth Allah- Alaih, 
He is known to perform the most awesome Shafie Mazhub Style of Tarahvee Salaat, with the best Kee-raat I've ever heard, which in my opinion is much more superior than our typical Hunafee way of Salaat.
 
 I hope someone can produce a translation of the book : Musnad-Ahmed bin Humble, click on the link below for an excerpt from his book : http://www.islamieducation.com/en/tawassul-intermediation/tawassul-14-musnad-ahmad-bin-hambal.html
When Gawthul-Adham Abdul-Qadir Kaylaani Alaih Salaat wa Salaam was asked whether there existed a person who was a wali of Allah who was upon a creed other than the creed of Ahmad ibn Hanbal, Hudruth Kaylaani RahmuthAllah Alaih answered: "That has not occurred and will never occur"
ALL GLORY & HONOUR BELONGS TO ALLAH ASAVAJAL WHO GAVE US THE FREEDOM TO FOLLOW ANY MAZHUB WE CHOOSE TO FOLLOW.

imamhusainistheperfectexampleofpatience.jpg

 
Homeopathic clinic offers 100% Halaal and painless alternative to the common OHIP covered flu shot( WHICH IS MOST LIKELY HARAAM-Against the Sharia of Islam !!!)
By Fred Sherwin
Orléans Online, edited by Sayyid Safe-uddean, the owner of this site!

Flu shot – two words that universally strike fear into the hearts of children big and small. With the flu season already upon us, parents are once again faced with the decision of either dragging their children kicking and screaming to their local flu shot clinic, or not bothering and risk possible contraction of the flu virus down the road.

While some parents will resort to everything from threats to bribery to try and convince their children to get a flu shot, there is a harmless alternative. The Hahnemann Homeopathic Clinic in Manotick is offering free oral flu “shots” as an alternative to the more traditional method of vaccination.

According to homeopathic practitioner Heather McKenzie, the traditional form of vaccination is not only frightening to young children, it’s also   potentially dangerous for their health.

Conventional vaccinations involve the direct injection of crude doses of the influenza virus made using chicken embryos directly into the blood stream. Such a delivery method bypasses the body’s natural defense mechanisms, says McKenzie.

Because the body is receiving such a strong shock to its system, reactions can often result from mild to severe. Homeopathic researchers believe that
in certain cases, continuous
vaccinations can lead to auto-immune disorders such as asthma.

Along with the virus material that is injected directly into the bloodstream, the vaccine fluid may also contain trace amounts of chemical agents such as the mercury based preservative thiomersal and formaldehyde.

The homeopathic flu remedy, on the other hand, contains no chemicals whatsoever. Rather a single drop of a highly diluted amount of influenza material is mixed with a lactose powder that is taken orally. The remedy triggers the body’s natural defense mechanism which begins to manufacture agents that in turn will combat the actual flu virus.

The material is processed through the body’s mucous membranes as it would be if the virus were contracted naturally.

Because the viral agent is so diluted and it is not mixed with a bunch of chemical agents it’s a lot easier on the system.

The oral remedy is especially recommended for infants and young children whose immune systems are not yet fully developed. Seniors or people with immune disorders can also take the remedy.

For more information on the oral flu shot or to make an appointment to receive the remedy call 613-692-6950.

(This story was made possible thanks to the generous support of our local business partners.)

Return to top

May ALLAH guide Sister Anna Sienicka  to the Noor of Islam, Ameen RSS

http://vaccinechoicecanada.com/alternatives/

 

 The origins of immunization date back to the 17th century when village healers in China and Sudan created medicine to ward off smallpox by formulating a powder from dried scabs taken from infected people. This crude medicine was then introduced into the bloodstream of uninfected people through scratches in the skin. Also known as ‘smallpox variolation’, this is a method of inoculating an individual against the smallpox virus (Variola) through deliberate exposure to a mild form of the virus in order to create a localized infection and thus generate immunity against further infection.

In 1796, Edward Jenner observed that milkmaids were generally immune to smallpox and postulated that the pus in the blisters that milkmaids received from cowpox (similar to smallpox) protected them from smallpox. Jenner tested his hypothesis by inoculating an eight-year-old boy, James Phipps, with cow pox. A few weeks later, Jenner exposed Phipps to smallpox and no symptoms developed.

Louis Pasteur further developed the technique during the 19th century, extending its use to agents protecting against anthrax and rabies, by treating the agents for those diseases so they lost the ability to infect. Today, vaccination campaigns are in use against a wide variety of diseases throughout the globe. 

Two Types of Immunity

Immunity describes a state in which the immune system has been primed to protect the body from a specific disease-causing agent (i.e. bacteria or viruses).

Natural – a permanent form of immunity which we are either born with or is produced by the body during our lifetime after recovery from exposure to a certain microbe. Natural immunity passes on to future generations genetically and through breastfeeding from the mother.

Artificial – a temporary form of immunity induced by introducing a manufactured medicine (i.e. vaccine) into the body, intended to imitate and accentuate the body’s natural response to infection. Because the effect of a vaccine is temporary, it has to be repeated for any long-term effects.

Vaccination Risks

Recent controversy around conventional vaccinations has influenced parents to choose more carefully. “The rise in drug resistant infections is comparable to the threat of global warming” said Sally Davies, the Chief Medical Officer for England, as reported on January 24, 2013.

While protection from a virus or bacteria is desirable, there is rising concern about preservatives used in the vaccines to prolong shelf life [viii, xiii]). Here are some of the ingredients that may be found in conventional Western vaccines:
• Aluminum hydroxide and phosphate
• Ammonium sulfate (soil fertilizer)
• Animal tissues: pig blood, horse blood, rabbit brain, dog kidney, monkey kidney, chick embryo, chicken egg, duck egg, calf (bovine) serum, washed sheep red blood cells, porcine (pig) pancreatic hydrolysate of casein
• Formaldehyde (known to be a human carcinogen)
• Human diploid cells (originating from human aborted fetal tissue)
• Monosodium glutamate
• Phenoxyethanol (anti­freeze)
• Sorbitol (artificial sweetener)
• Thimerosal (mercury)

According to VRAN (Vaccination Risk Aware-ness Network), these substances can have negative effects on infants, including autism, encephalopathy, brain damage, seizures, and coma [xv].

The first recommended vaccinations happen at two months of age and provide no guarantee the child will gain immunity after inoculation. Whether the child is allergic or sensitive to any of the above-named hazardous elements remains an unknown risk. Vaccinations are not mandatory in Canada.  Parents who wish to opt out of the vaccination programs supplied for kids at their schools need only fill out a special “Legal Exemption” form and have it notarized. (See end of article, re: how to obtain this form.)

What Is the Track Record of Homeopathic Immunization?

In my opinion, homeopathic immunization is a viable alternative to conventional vaccinations. Vaccines are usually made from disease material (virus or bacteria), also known as a nosode, and then prepared homeopathically (diluted hundreds or thousands of times) to render it completely safe and non-toxic. Only the energetic signature of the material remains after all these dilutions. No other additives or preservatives are used. Homeopathic immunizations are the size of the head of a pin and are administered by mouth. They dissolve easily in an infant’s mouth without danger of choking. Homeopathic vaccinations are safe and do not cause side effects. This is  a painless approach to immunizing a child that does not involve needles. Thankfully, children no longer need to be left with traumatic memories related to this process [i, viii, xiv, xii].

The outcomes of homeopathic immunization (homoeoprophylaxis) have been very successful. Results of a 15-year study done on 2,342 children by immunization expert Dr. Isaac Golden, Ph.D., showed the effectiveness of homeopathic vaccinations as 90%, suggesting homeopathic immunizations are as effective as regular vaccines, but without the hazards of regular vaccine toxicity [iv].

Another study on the effectiveness of homeopathic vaccination took place in October 2007 in Cuba. Researchers and Public Health officials collaborated in the homeopathic immunization of over 2 million persons against epidemic leptospirosis. The homeopathic vaccine was administered to 2.1 million people in the regions at highest risk of disease, where the statistical model had predicted close to a 100% increase for this period in 2007 [ix].

Of the remaining 11 million inhabitants only 15,000 persons (0.6% of the population) received a conventional vaccine. The results were impressive. Within two weeks of administering the homeopathic immunization in the intervention region, a 90% decrease in disease incidence was observed. In the past, the disease incidence always increased during this period, even with the administration of conventional vaccination. In the non-intervention region, the usual increase for this time of year had occurred.

There are eight homeopathic vaccinations that I recommend: pertussis (whooping cough), diphtheria, tetanus, haemophilus B, measles, mumps, rubella, and meningococcus. As well, influenzinum, tuberculosis, typhoid, hepatitis B, and polio are available upon a request. Each vaccination is given 4 times a month (once a week) with breaks in between. While homeopathic immunizations have been known to last for as long as ten years, it is recommended that a child be given the appropriate homeopathic remedy every 2 to 4 years depending upon his/her general health.

Children who have not been immunized in the above fashion or need to enhance their immunity for other reasons may take the 30c potency of the selected remedy every other day during periods when contagion is more likely.

A homeopathic version of the ‘flu shot’ for adults is also available and can be administered during the colder months.

References

A Shot in the Dark, Harris L. Coulter and Barbara Loe Fisher (1985)
[ii] Breastfeeding and Health in the 1980s: A Global Epidemiologic Review, Allan S. Cunningham in Journal of Pediatrics, Vol. 118, No. 5, May 1991.
[iii] Homoeoprophylaxis: Proven Alternative to Vaccination,  Isaac Golden, Ph.D
[iv] Homeoprophylaxis – A Fifteen Year Clinical Study, Isaac Golden, Ph.D. (2004)
[v] How to Raise a Healthy Child… In Spite of Your Doctor,  Robert S. Mendelson M.D. (1987)
[vi] “How Breastmilk Protects Newborns’” Jack Newman, MD, FRCPC
[vii] “How Breastfeeding Transfers Immunity To Babies,” Brigham Young University (2008, October 27).
[viii] Immunization: History, Ethics, Law and Health, Catherine J. M. Diodati M.A. (1999)
[ix] “Large scale application of highly-diluted bacteria for Leptospirosis epidemic control” by G. Bracho et al; Homeopathy, Vol. 99, No. 3, pages 156-166; July 2010.
[x] “Mucosal Immunity: The Immunology of Breast Milk,” H.B. Slade and S.A. Schwartz in Journal of Allergy and Clinical Immunology, Vol. 80, No. 3, pages 348-356; September 1987.
[xi] National Vaccine Information Centre:
www.nvic.org
[xii] Natural Cures “They” Don’t Want You to Know About, Kevin Trudeau (2004)
[xiii] What Your Doctor May Not Tell You About Children's Vaccinations, Stephanie Cave M.D., F.A.A.F.P., with Deborah Mitchell (2001)
[xiv] Vaccines: Are They Really Safe and Effective? Neil Z. Miller (2008)
[xv] Vaccine Risk Awareness Network:
www.vran.org Contact them for more information on the “Legal Exemption” form to opt out of vaccination. Email: info@vran.org
[xvi] “The Immune System of Human Milk: Antimicrobial, Antiinflammatory and Immunomodulating Properties,” A.S. Goldman in Pediatric Infectious Diseases.

Article Tags: vitality, vitality magazine, homeopathic remedies, homeopathy, vaccines, immunity, homeopathic immunizations, homeopathic vaccines, homeopathic immunization, immunizations, immunization risks, vaccination risks

About the Author

More Articles by Anna Sienicka

Anna Sienicka is a graduate of the Canadian College of Homeopathic Medicine. She also holds a B.A. with honors in Kinesiology and Health Science from York University. Contact The Herbal Clinic & Dispensary at (416) 532-8660 or email anna@homeopathiccare.ca   Visit: http://www.homeopathiccare.ca

- See more at: http://vitalitymagazine.com/article/homeopathic-vaccines-an-alternative-to-conventional-needles/#sthash.T2DHvZN8.dpuf

 

 

  
Once I went to Mcdonalds to eat a Fish-0-Filet Sandwich, with out, cheese.( A Grill order). 
 I noticed a woman wearing a hejaab  was ordering Chicken Nuggets, I asked her if she's a Muslim, she replied, yes!
 I said the Nuggets aren't Halaal, She said I'll just say, Bismillah before eating them.
Some Shafeye Mazhab fools believe everything is halal even if someone from Mcdonald says: "WE SHOOT OUR COWS TO DEATH" these shafeye mazhub fools will say just say: Bismillah, before eating.
In the Quranay Kareem, ALLAH says if it is not killed in the name of ALLAH
 IT ISN'T PERMISSIBLE TO EAT, get that in your MIND, inshALLAH
 Mcdonalds, Burgerking, Wendeys, and other Kafir Owned Restaurant chicken is usually NOT ZUBBEEHA that means:
 U CAN'T EAT IT UNLESS  THERE IS NOTHING ELSE TO EAT WHICH IS IMPOSSIBLE IF YOUR LIVING IN NORTH AMERICA! 

measachildinindiamakingdua.jpg

punishment.jpg

alhumdullillahthisisabeautifulsalawat.jpg
http://www.architectoflove.net/introduction/his%20life.html

thisbookisamongthebestmedicebooks.jpg

The Book I'm holding in my hand, "HEALING WITH THE MEDICINE OF THE PROPHET" authored by Imam Ibn Qayyim RahmuthALLAH alaih has been derived successfully from the hadith of Muhammad-RasoolALLAH SalAllahAlaheewas Salim, himself! MashALLAH, so go to this link and download it: http://islamfuture.files.wordpress.com/2010/07/healing-with-the-medicine-of-the-prophet-pbuh.pdf

amazingmountainremindsofjabalayqaf.jpg

My site is named after Mount Qaaf, the mysterious emerald mountain, however it's still dedicated to the Shadowless Prophet of Islam

We are living in a world of uncertainty and misconceptions. Man is beginning to question the very roots of his beliefs- Allah Almighty and the Holy Prophet Sall Allahu alaihi wa Aalihi wa Sallim, to create doubt in the minds of the simple and un suspecting Muslims. Some so-called scholars, not so long ago began a shocking campaign against the flawless personality of Allah Almighty in the form of 'the possibility of telling a lie ' ; which plunged the Muslim world into utter disbelief and shock. This misguided man wrote: "Allah has power over everything. Thus if He so wishes , He can utter a lie" (Allah Forbid). It is true, when Allah Almighty wants to destroy a person, He first takes away his sanity. This religious heretic conveniently forgot the Quranic verse: "Curse of Allah be upon the liars". Will Allah Almighty indulge in an activity which He himself has condemned? Unfortuantely, instead of dismissing this lie with the contempt that it deserves, many Muslims became the followers and disciples of this lunatic.

Another misguided intellectual tried to heap insults on the luminous personality of the Holy Prophet Sall Allahu alaihi wa Aalihi wa Sallim by questioning the extent of his knowledge. The commentators of the Holy Qur'aan maintain that in terms of knowledge, the Messenger of Allah Sall Allahu alaihi wa Aalihi wa Sallim is the sun and all the other Prophets are the galaxy of stars rotating around him. The majority of scholars of Islam maintain that his knowledge constitutes of what was, what is and what will be. Remember, by trying to cloud the sun you can't dim its radiance.

Now another group has sprung up, who are trying to gain recognition by using scientific knowledge as the basis of Imaan (faith). Anything contrary to this is discarded from their principles of faith. In this world there are two types of blind-- those who are born blind; and those who have vision, but refuse to see the light. These clones of science certainly belong to the latter. It is to educate this group that the Holy Prophet Sall Allahu alaihi wa Aalihi wa Sallim had said: "Where science ends, my Religion begins".

The Holy Qur'aan speaks of many miracles which are beyond the imagination of those who are tied to the cudgels of science, as they cannot be explained through scientific exposition. Some examples of these are:-

1. According to science, the quality of fire is to burn. Yet, when Hazrat Ibrahim Alaihis Salaam was hurled into it at the command of Namrood, not a single hair of this great Prophet of Allah was destroyed.

2. Science teaches us that the moon is thousands of miles away from the earth. Yet, the Holy Prophet Sall Allahu alaihi wa Aalihi wa Sallim split this moon into two, the two halves came into the sleeves of the Messenger of Allah Sall Allahu alaihi wa Aalihi wa Sallim and within seconds went back to appear as a single entity.

3. Scientific data explains that iron can only melt under great heat, yet this same iron melted in the hands of Hazrat Dawud Alaihis Salaam.

4. Leprosy, blindness, etc. according to science are virtually incurable ilnesses, yet a mere touch of the blessed hand of Hazrat Isa Alaihis Salaam cured the victims of these. Even more incredible is the restoration of the eyesight of Hazrat Yaqub Alaihis Salaam by touching the shirt of Hazrat Yusuf Alaihis Salaam.

Can these people who are influenced by Western culture deny the veracity of these miracles? If these are possible, then why is it difficult to accept the miracle of the Holy Prophet Sall Allahu alaihi wa Aalihi wa Sallim not possessing a shadow ? Do they have any conclusive proof from a single Hadith to prove to the contrary ?

Here is proof from Ahadith-e-Nabawi and from the writings of great and authentic scholars of Islam which show beyond a shadow of a doubt that the Messenger of Allah Sall Allahu alaihi wa Aalihi wa Sallim did not possess a shadow.

  • Hadith 1 : Hazrat Hakeem Tirmizi in his book NAWAA DARUL USOOL narrates from Hazrat Zakwaan Radiyallahu Anhu , a close Companion of the Holy Prophet Sall Allahu alaihi wa Aalihi wa Sallim, the following Hadith: "The shadow of the Holy Prophet Sall Allahu alaihi wa Aalihi wa Sallim could not be seen in the brightness of the sun, nor in moonlight".

  • Hadith 2 : Allama Jauzi in his KITABUL WAFA narrates a hadith from Hazrat Abdullah ibn Abbas, the cousin of the Holy Prophet Sall Allahu alaihi wa Aalihi wa Sallim: "Allah's Rasul had no shadow, not while standing in the sun, but the brilliance of his Noor surpassed the rays of the sun; nor while sitting before a burning light, but his luminous Noor excelled the lustre of the light".

  • Hadith 3 : Imam Nasafi in his TAFSEER MADAARIK narrates from Hazrat Uthman ibn Affan Radiyallahu Anhu, the son-in-law of the Holy Prophet Sall Allahu alaihi wa Aalihi wa Sallim. Hazrat Uthman said to the HolyProphet SallallahuAlaihi Wasallam: "Allah Almighty does not let your shadow fall on the ground, so that no foot of man can fall on it".

  • Hadith 4 : Imam Jalaludeen Suyuti in his KHASAAISUL KUBRA narrates from Ibn Saba Radiyallahu Anhu: "This is also a unique feature of the Holy Prophet Sall Allahu alaihi wa Aalihi wa Sallim that his shadow did not touch the ground, because he was Noor, and when he used to walk in the sunshine his shadow could not be seen".

What the great scholars have to say about this subject

Having read the words of those who had lived with the Holy Prophet Sall Allahu alaihi wa Aalihi wa Sallim and had closely watched his every action, we shall now turn to some great scholars of Islam, whose writings are considered most authentic in Islamic affairs. Pay heed to these to dispel any doubts that you may have regarding the subject. All these great scholars firmly believed that the Holy Prophet Sall Allahu alaihi wa Aalihi wa Sallim did not possess a shadow.

Imam Qazi Ayaaz

1. Imam Qazi Ayaaz in his ASH-SHIFA states:"The Holy Prophet Sall Allahu alaihi wa Aalihi wa Sallim did not possess a shadow in the brightness of the sun or in the moonlight, because he was Noor (light)".
 

Imam Ahmad Qastalani

2. Imam Ahmed Qastalani states in AL-MAWAHIBUL LADUNYA: "The Holy Prophet Sall Allahu alaihi wa Aalihi wa Sallim did not possess a shadow in the brightness of the sun or moonlight is proven from the Ahadith of Tirmizi Sharief of Ibn Zakwaan and Ibn Saba".
 

Sheikh Abdul Haq Muhaddith Dehlvi

3. Shaikh Abdul Haq Muhaddith Dehlvi states in MADARIJIN NUBUWAH: "The Holy Prophet's Sall Allahu alaihi wa Aalihi wa Sallim shadow did not appear in sunshine nor in moonlight".
 

Maulana Jalaluddeen Rumi

4. Maulana Jalaluddeen Rumi in his MATHNAWI SHARIEF states: "Let alone the Holy Prophet Sall Allahu alaihi wa Aalihi wa Sallim, even if an ordinary servant of the Holy Prophet Sall Allahu alaihi wa Aalihi wa Sallim reaches the stage of inner mortality (BAQA), then like the Prophet Sall Allahu alaihi wa Aalihi wa Sallim, his shadow too disappears".

May Allah Almighty give us the guidance and strength of Imaan to remain steadfast on the Straight Path. Aameen.

Mount Qaf (Mysterious Emerald Mountain) According to Imam al Tabari

The following tradition is attributed to the Holy Prophet Muhammad SallALLAH walahee Wa Salim (peace and blessings be upon him) and is recorded by Tabari in,‘Chronique de Tabari’.

Here is how the Prophet S.A.W (peace and blessings be upon him) replied concerning Djaboulqa and Djaboulsa:

“These are two cities, one in the East and one in the West. Djaboulqa is in the East and Djaboulsa in the West. These cities are of emerald and both are linked to the mountain Qaf. They have both twelve thousand parasang in length and twelve thousand parasang in width.”

The Prince of Believers ‘Ali KarmAllahu Wajhoo alaih Salawaat wa Salaam(peace be upon him) honored Father, and great son of Hadrath Abu T’Alib was in presence of the Prophet (peace and blessings be upon him) when the Jews came from Khaibar, Fadak and those of Beji Qoraidha. The Jews came with Abu Jehal and W’Alid-ben-Mogaira to see what the Prophet S.A.W (peace and blessings be upon him) said was tally with the Pentateuch and the traditions.


Hadrath ‘Ali  KarmAllahu Wajhu Radee-Allahu- Anhu (may Allah be pleased with him) said, “O Apostle of Allah, these two cities (Djaboulqa and Djaboulsa) are they in the same world we are living?”

The Prophet (peace and blessings be upon him) replied, “The two cities are situated in darkness and contiguous to the mountain Qaf.”

‘Maula Ali R.A (may Allah be pleased with him) asked, “How many inhabitants are there in these places?” The Prophet S.A.W (peace and blessings be upon him) replied, “Each of these cities has fortresses and in each fortress there is a garrison of 1000 men who keep on guard each night. The tour (of guard duty) of the men who once keep on guard does not return until the next year”.

‘Imam Ali R.A (may Allah be pleased with him) asked, “why should there be so great number of people to guard on that place?”

The Prophet S.A.W (peace and blessings be upon him) replied, “Because in these places there are an enormous quantity of gems which belongs to these people whom we call-Tharis and Taqil, they are the enemy of the Djaboulqa and Djaboulsa. They are unceasingly at war night and day. They fight with themselves. It is because of these people that there are these guards and these sentinels”.

Hadrath ‘Ali alaih Salaam (may Allah be pleased with him) asked, “Do the inhabitants of Djaboulqa and Djaboulsa form part of the children of Adam alaih Salaam?”

The Prophet S.A.W (peace and blessings be upon him).replied, “they do not even know Adam alaih Salaam.”

‘Sayideena Ali alaih Salaam (may Allah be pleased with him) asked, “has the devil penetrated there?” The Prophet S.A.W (peace and blessings be upon him) replied, “neither do they know it (the devil).”

‘Imam Ali R.A(may Allah be pleased with him) asked “do the sun and the moon shine on them?” The Prophet S.A.W(peace and blessings be upon him) replied, “They know not that Allah has created the sun and the moon.”

Hadrath ‘Ali R.A(may Allah be pleased with him) asked, “Then how do they see?” My Master Muhammad SallALLAH walahee Wa Salim(peace and blessings be upon him) replied, “light comes to them from the mountain Qaf, and their walls, their stones, and their dusts are all shining as lights.”

‘Maula Ali KarmAllahu Wajhu (May Allah Honor his blessed face) said:

“O Apostle of Allah, what do they eat?”

The Prophet S.A.W (peace and blessings be upon him) replied, “the herbs that grow on the earth.” Imam‘Ali R.A(may Allah be pleased with him) asked, “what do they wear?”

The Prophet S.A.W(peace and blessings be upon him) replied, “they have no need to cover their bodies with garments.”

‘Imam Ali R.A (may Allah be pleased with him) added, “so, they are angels.”

My Master Muhammad S.A.W(peace and blessings be upon him) replied, “No, but their obedience to Allah is similar to the angels.”

‘Imam Ali R.A (may Allah be pleased with him) asked, “do they have kids?”

The Prophet S.A.W (peace and blessings be upon him) replied, “they desire not to have for they are all males and they have no females.”

‘Imam Ali R.A (may Allah be pleased with him) replied, “are they among the Elects or of the damned?” The Prophet S.A.W (peace and blessings be upon him) replied, “they are among the Elects, because they follow the religion and the laws. And they have professed Islam. In the night of Mi’raj when Jibrail alaih Salaam took me to heaven, he took me thence to these people. I offered them Islam, they believed in me and in Allah. I appointed a C’Aliph among them from among their own nation and I taught them Islam. Jibrail alaih Salaam then took me to Tharis and Taqil and towards Yajuj and Majuj; they were infidels and did not accept Islam.”

Then My Father Muala ‘Ali R.A(may Allah be pleased with him) asked, “O, Apostle of Allah, can any man reach that place?” The Prophet S.A.W (peace and blessings be upon him) replied, “No man has the power to reach these people because one has to walk four months in darkness! Meanwhile at the time of Prophet Hud alaih Salaam, three men among the Adites who became Muslim and who believed in the Prophet Hud alaih Salaam, fled their people, and reached these cities.”

Some people pretended that Djaboulqa and Djaboulsa are situated to where the sun sets. We are also told that, the inhabitants of Earth would have heard the rising and the setting of the sun, had not these people created tumults and noises at these cities. Hadrath Dhul-Qurnain alaih Salaam remained two months in the darkness willing to reach these mysterious cities, however he failed as he needed to walk for two more months in the darkness.

The Jews of Medinah Al-Munawwara having heard these stories said, “We have seen the same things in the Pentateuch.” Now the three persons who fled the A’d people arrived at Djaboulqa and Djaboulsa, and they stayed there. They were tormented by the people of Fid. They wanted to escape, but they could not. For these people have more power than they do.  MAY ALLAHUQADEERU ALLAHUQADIRU SHOWER SUCH BLESSINGS ON OUR NABI SULL-ALLAH-WALAHEE WA SALIM, THAT OUR SPIRITUAL POWERS INCREASE & MAY ALLAH INCREASE US IN KNOWLEDGE= RUBBEE ZIDNEE ILMAAN, AMEEN

 
May ALLAH asavajal, Bless the soul and enlighten the grave of my dear friend  Hadruth ABU BAKR, the Champion of Truth, "Martin Lings" for writing this wonderfull book. I'ts excellently written with a new emerald green cover MashALLAH, now on sale at Amazon.ca!. I highly recommend this for new muslims!
 

Muhammad
 
See larger image
 
theheartofislam.jpg

shaykhabdel_qadir_isa.jpg

thisistherealpictureoftherozaaymubaaruck.jpg

The mosque of Imam Ali ibn Abi Talib (kaw)

 
 
786
  Although I'm unmarried, I've designed an Islamic Marriage Website, packed with Islamic LAW info:
 
If your a SUNNEE Lover of Maw-lah Ali KarmAllahu Wajhoo alaih Salaatu was-Salaam, I advice you to pray to ALLAH asavajal that He protect us, and our innocent Christian friends :
http://www.christiansofiraq.com/future.html 
from the evil of the deceptively- treacherous Rafidee She-ites , by the honor of Qamaray Bunee Hashim Abbas Alumdaar, whose Furat Spring, I had craved to drink from in Karbalah, but couldn't due to the Greatest Fast of my Life, Ameen! 
 
http://aladaab.files.wordpress.com/2009/12/ihya_ul_mayyit_bi_fadhail_ahlul_bayt.pdf
 
I't seems from the Documentary "Iraq in Fragments" http://www.iraqinfragments.com/synopsis/index.html
that the She-ite Devils, wearing Neqaab like women, have made Iraq even worse than it was at the time of  Saddam Hussain.
 
Allthough I may sometimes read books written by Rafidi Shia,(Then I was Guided)-Refutation at
 
http://islamicweb.com/beliefs/cults/Taijani/9.htm 
however it doesn't mean I agree with the authenticy of them.
 
 One of my favourite Sunni Scholars is Mualaana Jalaal-uddean Suyuti
 Rahmuth-Allah Alaih who wrote: Musnad Fatima al-Zahra' radiya Allah anha wa ma warada fi Fadliha <1994> ("The narrations traced back to Fatima the Radiant and the reports concerning her virtues")
 
IRSHAD a book of the Jerrahi Tareeqah is also among the greatest of all books!
 
I've listed an extract from it below:
 
A Râfidi Shia Experiences an Instructive Dream
taken from Irshad
by Sheikh Muzaffer Ozak al-Jerrahi

   A Râfidi is a schismatic who hates Hazrat Abu Bakr, Umar and Uthman, and who dares to pretend that he thereby proves his love for our master Ali the Elect. See what befell one of these, how he met with a welcome and a rebuff:

   A certain Rafidi once dreamt that the Resurrection had begun; mankind had gathered at the Place of Resurrection and when he approached the pond of the Nabi (s.a.s.), a blessed individual filled a cup and offered it to him. "Who are you?" asked the Rafidi, and the reverend being replied:

"I am that person who was the first of the great to believe in the Most Noble Messenger. I am the one who accompanied the Messenger throughout his life in all his battles, who spent all his wealth in his cause and was content to wear a simple cloak. His minister in his lifetime, his successor at his death, his companion in the cave, his father-in-law by divine decree; it was I who led the pray in his prayer-niche while he was still alive. Intercessor for half of this Community, I am the one who prayed that my body might be enlarged to fill all the space in Hell, leaving no room in the Fire for the Community to burn!"
The Rafidi withdrew, saying: "I understand. You are Abu Bakr. I shall not drink water from your hand! Ali is all I need." A little further on, he encountered another blessed individual, likewise dispensing from the Prophet's pond. He asked him who he was...

  This person replied:

"I was the fortieth Muslim, whose true faith and submission were manifested together, father-in-law to the Messenger, father of Hafsa, together with the Messenger of Allah in all his battles, my judgement the subject of seventy seven Ayats of the Holy Qur'an, the second Khalif of the Nabi, his consultant during his lifetime, the son-in-law of Ali the Elect. Of me he said: 'Had there been a Prophet to come after me, it would have been Umar ibn al-Khattâb.' I am the man who conquered Syria, Egypt, and Persia; who gave commands to an army at a distance of three months' marching time; who drove the fire from the Yemen; who made the River Nile comply with my orders; deliverer of the Aqsa Masjid; who cared nothing for the world below; who wore a cloak of forty patches, even though the Muslim Treasury was filled to overcrowding; in whose Khalifat the sheep and the wolf shared pasture, the wolf not daring to attack the sheep."
The Rafidi withdrew once more, saying: "I understand. You are Umar ibn al-Khattâb. I shall not drink your water, either. I shall drink from the hand of Ali the Elect." Again he was met by a blessed individual, who offered him a cup of water from the pond of the Messenger, and again he asked: "Who are you?" This time, the reply was:
 
   "I am the one who married two of the Messenger's precious daughters; when my wives passed over to the Hereafter, the Messenger said of me: 'If I had had hundreds of daughters, I would have given them to Uthmân.' I am the one to whom the Messenger said: 'O righteous Uthmân, pray for me.' I am the amanuensis of the Holy Qur'an. The angels are shy of me. Victim and martyr am I. With fasting mouth I made the final testimony. I spent my wealth in the cause of Islam. Although an Umayyad, I was one of the first to believe. I was congratulated in my lifetime on the promise of Paradise. I am the Messenger's third Khalif."

   When the Rafidi heard this, he said: "You are Uthmân. Your water is not good to me either." His words saddened Hazrat Uthmân. The man moved away, to be met by a blessed individual with the build of a lion, who also greeted him kindly. Once again he asked:

"Who are you? and that worthy individual said: "I am the Lion of Allah; owner of the sword called Dhul-Fiqar; victor of Khaybar; cupbearer of the water of Paradise; husband of the Messenger's dearly beloved daugher Fatima the Radiant; father of Hasan and Husayn; greatest of the People of the Nabi's Household; concerning whom many Qur'anic Verses were sent down; of whom the Messenger said that those who hate me are hypocrites, while those who love me are believers; whose dignity is proclaimed in the Prophet Tradition: 'Of those whose master I am, Ali is master also;' the first child to believe in the Messenger; at the Messenger's side in all his battles; who lay in the Messenger's bed at the Hijra, ready to sacrifice his life to help him escape; drowned in the sea of affliction; the compliant and open-hearted one am I."
When the Rafidi heard this, he cried: "You are Ali the Elect. I recognize you. O Imâm, before you I was offered by Abu Bakr, Umar, and Uthmân, but I did not accept their offerings." The face of the Lion of Allah became suddenly flushed at these words. He gave the Rafidi a mightly slap in the face, saying: "One who does not drink their water, shall not drink our water either!" When the Rafidi recovered consciousness, he saw that he had spewed thirty-two teeth into the palm of his hand. He repented, felt remorse for his actions and forsook his hatred of our masters, Hazrat Sheikhs Abu Bakr, Umar, and Uthmân, may Allah be pleased with them all.
photo
 

beehivebrown.jpg

bismillahinbeatifullblueshade.jpg

iaddedtheseflowertotheayatulkurseemashallah.jpg

luxor.jpg

One Hour of Contemplation Surpasses Sixty years of Worship

Abu Hurairah (Rad.) reported that Prophet Muhammad SALLAH WALAY HE WA SALIM (Peace Be Upon Him) said that contemplation for one hour (sa'at) is better than worship for 60 years. Hadith.

In the subsequent matters, we draw your attention in such a way to the truths and manners of creatures coming into existence that, on the one hand, we grasp the essential favor of healthy organs that are created under the control of the Exalted Unique Being. On the other hand, it will fully become evident that if it were not for the supervision of the Sole Creator, as in the verse: "Then He fashioned him in due proportion," and if we were created by chance or spontaneously, we would definitely suffer the deficiencies described in the following discussion.

In the name of God, who opened the door of nothingness, and from it created billions of types of creatures, living, non-living and so forth, with incredible and rare forms and sorts, we start with the following matters. What would we have been if Almighty God had not brought us out of that nothingness, a state of non-existence, to create us in the best shape and figure? 

Translation: "We have indeed created Man in the best of molds." (95:4Q)

If Divine Will was to create us, then ponder! What would we have done, had we been created in the category of inanimate entities, such as rocks, sand, mines, trees, fruits, grains, vegetables, and thousands of other like objects.

Let us submit that He had intended to create us as living entities.

What if we were created in the category of thousands of non-human organisms, on land or in the seas, such as microbes, mosquitoes and, at the very most, sheep, horses, goats, elephants or some birds or in the form of some other creatures? What would we have been then?

After all why O' man! Vicegerent of the Almighty Lord of the earth and heavens, don't you ponder that before your creation, the Exalted Most Gracious and Most Merciful had bestowed all these Favors unto you?!

Let us acknowledge that His Will was to create our selves in the form of mankind!

astaghfirullahforeveryonegood.jpg

abughadamakingdua.jpg

What is Qurbani/‘Udhiya?

Qurbani or ‘Udhiyah is an act of worship and it involves the slaughter of an animal during Eid ul-Adha and the three days that come after (10th-13th Dhul Hijjah). The qurbani commemorates Prophet Ibrahim's willingness in obeying Allah’s orders and the ultimate sacrifice of his son, Isma’il who was replaced by an animal at the time of sacrifice.

In which countries do you perform qurbani?

We currently provide qurbani services in the following countries: Afghanistan, Azad Kashmir, Bangladesh, Burma (refugees), Djibouti, Ethiopia, India, Kenya, Occ. Kashmir, Pakistan, Gaza, Sierra Leone, Somalia, Sri Lanka, Sudan and Yemen.

How much does a qurbani cost?

The qurbani prices vary country to country. Please check our website www.ukim.org/qurbani for a full price list.

Who is required to offer qurbani?

According to Imam Abu Hanifah, offering qurbani is obligatory (wajib) on every Muslim (male or female) who holds a minimal level of wealth (nisaab), is of sound mind, has reached the age of puberty and is not a traveller. The other jurists regard offering qurbani as being a highly recommended Sunnah. Please refer to your local Imam or a trustworthy scholar for more info.

What is nisaab?

Nisaab is the minimum threshold of wealth held by a Muslim. If a Muslims holds wealth above this level, it is obligatory for him to offer qurbani according to the Hanafi madhab. Generally, those who pay zakah also have to give qurbani.

What should someone who intends to offer a sacrifice refrain from doing?

It is not allowed for the one who wants to offer a sacrifice to remove anything from his hair, nails or skin, once the new moon of Dhu’l-Hijjah appears (1st of Dhul-Hijjah) up until he has offered the sacrifice.

The Prophet (SAWS) said: “When you see the new moon of Dhul-Hijjah, if any one of you wants to offer a sacrifice, then he should stop cutting his hair and nails until he has offered his sacrifice." According to another report he said: "He should not remove (literally, touch) anything from his hair or skin." (Muslim)

I didn’t offer qurbani; what should I do?

The Prophet (SAWS) said:
"Whoever has the capacity to sacrifice and does not do so, should not come to the place where the Eid prayer is offered." (Ibn Majah)

If someone out of ignorance or negligence did not offer qurbani, he/she should then give the equivalent as sadaqah. This does not mean that sadaqah is an alternative. How does UKIM decide who receives the qurbani meat & how do you distribute it?

 

This is my favourite meal, MashALLAH
imisseatinglambslikethis.jpg
May ALLAH GIVE THIS TO US BOTH IN DUNIYA AND IN JANNAH, inshALLAH

Although I prefer to feed the Sufi loving Arabs at Babul-Shaykh in Baghdad, doing business with our local brother-Ameen Bhi is also a blessing! PPraises of ALLAH, combined with Salawat and mention of my name can lead him to give you a discount, inshALLAH at his Zabeeha Halaal Grocery Store! http://www.zabeeha.ca/contact.html https://blossompure.wordpress.com/products/ In my opinion African Food Tastes the Best when blessed Shaykhs like Abu Gahdah, read Salawat and Fatiha and other Waza-if(litanies) to put ANWAR (Spiritual Light) into the ingredients Below is a photo of Shaykh Abu Ghada, I heard from Shaykh Tauheed Tufail, he in Kenya but has a room in a Masjid of Abu Dhabi. I hope all Nigger brothers will benefit from him, inShALLAH

thisisanwarayabugadaah.jpg

SUNNI ISLAM is the Best, the Stone Ring info, is borrowed from a Shia-Muslim site, which I hope is true.

 

 A Shia-tradition, states that the Holy Prophet  Sull-ALLAH-walahee wa Salim directed men to cut the nails very near to the flesh while women were allowed to leave them a little as it is a source of beautification for them. [Hilyatul Muttaqin, by Baqir Majlisi, page #39]

It is highly commendable to wear a ring on the right hand, although some traditions do allow the ring to be worn on the left also. However, if the ring has any precious stone set in it, or has any holy engravings on it, it should be removed before going to the toilet.

In one of his traditions, Salman Farsi  R.A narrates a conversation which took place between the Holy Prophet S.A.W and Imam Ali in which the former gave some instructions regarding the wearing of rings. The Prophet S.A.W advised the Imam to wear the ring on his right hand, as by doing so, one would be included among the muqarrabin (those near to Allah)....Imam Ali KarmAllahu Wajhu further asked which ring he should wear, and the Prophet S.A.W advised him to have a ring set with red Aqiq (Cornelian), as this stone had affirmed the Oneness of Allah, the Prophet hood of Muhammad S.A.W, the vicegrency (Khilafat) of Hadrath Syedina Ali Rudee-Allahu anhu and Paradise for the Sunnees that are in reality the Real followers of Hadrath Ali alaih Salawaatu wa Salaam.

[Hilyatul Muttaqin, by Majlisi, chapter #2, page #14]


1. Aqeeq (Cornelio or agate)
These are available in several colours: white, milky white, yellow,
green, black, red, grey, liver colour and many others. The best are
the liver colour from Yemen, which are difficult to obtain and expensive. It has great religious significance and for people like myself it's highly preferrable.

The benefit of Aqeeq is that it creates joy in the heart, is good
for eyesight and it helps illuminate sadness and anger. It is also
revered in other religions and has been in use from the time of
Hazrat Adam (a.s.). It absorbs the rays of the sun and passes these
onto the body and is good for health. Black Aqeeq protects children
from envious eyes. Hazrat Imam Jaffer as-Sadiq (a.s.) has said that
a namaz with Aqeeq is 40 times better than one without it. It is
also great thawaab to use tasbeeh of aqeeq as said by Hazrat Imam Musa e Kazim (a.s.)

2. Firoza (Turquoise)

It is said that Firoza helps to create joy in the heart, helps
improving eyesight, brain and the heart. The Ancient Egyptians used
it. The best quality of Firoza are found in Nishapur (outside
Mesh'had), Iran but they are also available in Australia, Afghanistan, America, Egypt, Germany, Israel, Nepal and Tibet.
The great philosopher, Aristotle, said firooza helps to create
humbleness pity for others and is good for diabetics. It protects
from the stings of a scorpion, snakebites, lightening and drowning.
The community holds a Firoza wearer in esteem. The Holy Prophet, My Master and Commander Muhammed Al-Arabi
S.A.W.) said that Allah (S.W.T.) accepts the prayer of one who
wears Firoza. The Holy Prophet (S.A.W.), Imam Ali (A.S
and Hazrat Imam Musa e Kazim (a.s.) wore a Firoza ring.
If calamity were to befall on the wearer, the stone would break.

When this happens, the ring should be immediately be removed.

3. Durr e Najaf

It is obtained from Najaf al-Ashraf. Those obtained from the river
are more illustrious than those obtained from the land. Both Hazrat
Imam Jaffer as-Sadiq (a.s.) and Hazrat Imam Hassan al-Askari (a.s.)
have said that wearing of Durr e Najaf has great thawab. It is good for ailments
of the eye and it creates happiness in the heart.

4. Hadded - e - Cheen
They come in grey and black colours, but black is better. It helps
ease the pains of childbirth. Hazrat Imam Jaffer as-Sadiq (a.s.)
asked one of his friend who feared the wrath of the Sultan to wear
Hadeed with 'Haft Jalali' engraved thereon and he was spared. It
should not be worn constantly, but whenever necessary. Hazrat Imam
Ali (a.s.) wore Hadeed during wars. It is recommended
to wear during travels.

5. Yaqut (Ruby) - Manek

It has good effect on married life, friendship, loyalty and
business. It protects against hysteria, cholera, plague, rheumatism
and heart ailment. Hazrat Imam Ali (a.s.) used to wear one and it
is the ring that he gave away to the beggar in the state of ruk'uu.
Hazrat Imam Redha (a.s.) has recommended it for all mo'amins. In
Surah Ar Rahman: Ka anna hunnal yaqutu wal marjan.

6. Zamarrud (Emerald)

It is the best stone in all green stones. It is attributed to Hazrath Imam Hassan al-Mujtaba (a.s.) - 'suz kafa'. Hakim Aflatoon has said the wearer of Zamarrud overcomes his enemies. It protects against the ailments of the eyes and liver. It creates joy and peace of mind, promotes goodwill and inclines towards charity. If a calamity is to befall the wearer, it will break into small pieces. Both Hazrath Imam Ali (A.S.) and Hazrat Imam Musa al-Kadhim (Rahmuth Allah alaih.) have recommended it.

7. Marjan (Coral)

The Holy Quran refers to this stone in the following two ayats: Ka anna hunnal yaqutu wal marjan and Yakhruju min huma lualoo wal marjan. Marjan and pearls are among the gems obtained from the sea. It is good protection from paralysis, disease of the heart, liver, stomach, kidney and the effects of blackmagic.

https://www.change.org/p/canadian-government-officals-no-dog-cat-meat-change-canadian-laws


http://dailyhadith.abuaminaelias.com/2012/09/30/hadith-on-animals-allah-has-forgiven-a-prostitute-because-of-her-kindness-to-a-thirsty-dog/




This song is dedicated to the Kitten that used to sleep on my chest in my childhood http://www.deenislam.co.uk/cats.htm

 
Click below to Checkout the Milaadun -Nabi SallAllawalahee-wa salim Celebration in Makkah Al-Mukaraamah!

allahisfreeofallneeds.jpg

 

tombofibnarabirahmuthallahalaihwasalaam.jpg

Click this & visit my ISLAMIC Site for Vital Islamic Info!

 

underline

Home page

underline

About Ibn 'Arabi

underline
underline

Future Titles

underline

Tours

underline
underline

Ordering

underline

PUBLICATIONS

BY IBN 'ARABI

The Seven Days
of the Heart

Wird

Contemplation of the Holy Mysteries

Mashahid al-asrar

Divine Sayings:
101 hadith qudsi

Mishkat al-anwar

A Prayer for Spiritual Elevation and Protection

Dawr al-a'la

Four Pillars of Spiritual Transformation

Hilyat al-abdal

The Universal Tree and the Four Birds

Ittihad al-kawni


BY OTHER AUTHORS

The

Unlimited Mercifier

Ibn 'Arabi and Modern Thought

The Nightingale in the Garden of Love

The poems of Üftade

Beshara and
Ibn 'Arabi

 

 

Muhyiddin Ibn 'Arabi (1165–1240)

Muhyiddin Ibn 'Arabi is unquestionably one of the most profound and remarkable figures in the history of world spirituality.

Known as "the Greatest Master" (al-Shaykh al-Akbar), he led an extraordinary inner and outer life. He travelled huge distances, from his native Spain to Syria and Turkey, writing over 350 books on the mystical path.

Ibn 'Arabi's writings are founded on a totally harmonious vision of Reality, integrating all apparent differences without destroying their truths. They are singularly appropriate and needed in the world of today.

He lived at a time of great cultural and spiritual flowering in the West, in the Jewish and Christian traditions as much as in the Muslim world.

 

The interior of the Great Mosque in Cordoba

Ibn 'Arabi is one of those rare and powerful spiritual individuals who are the norm of their own orthodoxy and of their own time, because they belong neither to what is commonly called "their" time nor to the orthodoxy of "their" time.
Henri Corbin

The greatest mystical genius of the Arabs, he has left his mark on all subsequent mystical literature.
A. J. Arberry

In the Islamic world, probably no-one has exercised deeper influence over the intellectual life of the community over the past 700 years.
William C. Chittick

http://www.ibnarabisociety.org/works.html


A horse-shoe arch in Marrakesh

It is reported that the Messenger of God said: "God is beautiful and He loves beauty".
It is God who made the world and brought it into existence. The entire universe is therefore supremely beautiful. There is nothing ugly in it. On the contrary, in it God has brought together all perfection and all beauty.
Futuhat al-Makkiyya

 

Ibn Arabi's Universal Tree and the Four Birds

1326k - Adobe PDF - View as html
Four Birds (Ittihad al-kawn), Oxford: Anqa Publishing, 2006. ... level the anqa' is a mythical bird, a gryphon or a phoenix. 17 ... The bird's full name, anqa ...

www.lied.ku.edu/creative/mack.pdf - More from this site

If you would like further information or help, you can contact us by clicking here: publishing@anqa.co.uk

Anqa Publishing
PO Box 1178
Oxford
OX2 8YS
UK


Hadruth Ibn Arabi (RadiyAllahu Anhu) at a Church:

One day, one of Ibn Arabi’s opponents was taken sick, stayed in the home.The Shaykh went to visit the sick. he knocked the door and asked the sick man’s wife to inform him that he wished to meet him and pay his respects. The woman went to her husband and conveyed the message and returning to the Shaykh, told that her husband didn’t wish to see him. The Shaykh had no business in this house, she told him. The proper place for him was the Church. The Shaykh thanked the women and said that since a good man like her husband would certainly not send him to a bad place, he would comply with the suggestion. So after praying for his health and welfare of the sick man, the Shaykh departed for the Church.


When he arrived at the Church, he removed his shoes, entered with humble courtesy, and slowly and silently headed toward a corner, where he sat down. The priest was in the midst of delivering a sermon to which Hazret Ibn Arabi (Q.S) listened with the utmost attention. During the sermon, the Shaykh felt that the priest had slandered Jesus Christ (Peace be upon him) by attributing to him the claim that he was son of God. The Shaykh stood up and courteously objected to this statement. “O venerable priest,” he began “Holy Jesus Christ did not say that. On the contrary, he foretold the good news of the arrival of the Prophet Ahmad (Peace and blessings of Allah be upon him)”.


The priest denied that Jesus (Peace be upon him) had said this. The debate went on and on. Finally the Shaykh, pointing to the image of Jesus on the Church wall, told the priest to ask Jesus himself. He would answer and and decide the issue once and for all. The priest protested aggressively, pointing out that a picture could not speak. The picture would speak, the Shaykh insisted,for God, who had made Jesus speak while a baby in the arms of holy Virgin Mary (Peace be upon her), was able to make his picture as well. The congregation following the heated debate became excited at this statement. The priest was forced to turn to the image of Jesus and address it: “O son of God! Show us the true path tell us which of us is right in our claim.” With God’s Will, the picture spoke and answered: “I am not the son of God, I am His Messenger, and after me came the last of Prophets, the Holy Ahmad; I foretold that to you, and I repeat this good news now”.


With this miracle the whole congregation accepted Islam and, with Hazret Ibn Arabi leading them, marched through the streets to the Masjid. As they passed by the house of the sick man, he could be seen within, his eyes wide open in astonishment, looking out of the window at this curious sight. The saint stopped, & blessed and thanked the man who had insulted him, saying that he was to be praised for the salvation of all these people.

   



 BOY, 5, Converts 1,000 To Islam

There are orphans and street children everywhere. So much so that the sight of another small child standing on a street corner hardly merits a second glance.

But only when a boy opens his mouth to speak do onlookers realize that Shariff Idd is special. The five-years-old speaks in five languages - English, French, Italian, Swahili and Arabic - even though he is completely uneducated.

Shariff is a preacher who draws crowds of thousand in Kenya to his increasingly regular sermons. The Lybian leader, Colonel Muammar Al-Gaddafi, is a great supporter following an audience with him earlier this year.
Last week was a milestone for the child introduced to gawping throngs as the "Miracle Boy" of East Africa. He smiled triumphantly when told he had notched up his one thousand conversion to Islam in a country where Muslims are a minority.

Tours of France and Britain now beckon, according to Haji Maroulin, one of the boy's four guardians. He will travel as a missionary on a trip to be financed by a businessman from the Ivory Coast.

"When he is not preaching he is just like any other kid," Haji Maroulin said. "But when he preaches he changes.

At one year old he was able to recite the Quran and went on to be able to preach in Arabic, Swahili and French without any learning. The number of his converts is growing daily."
For a child he has strangely adult mannerism. He speaks confidently, mainly in Swahili unless he is delivering a sermon. Then, he fixed his piercing brown eyes on the person he is addressing without inhibition.

His squeaky child-like voice mesmerizes audiences.
According to Haji Maroulin, Shariff was born into Swahili-speaking Catholic family in Arusha, north Tanzania, in December 1993: "At the age of two months he refused to suckle his mother's milk and at the age of four months he started reciting verses from the Holy Quran."
The boy's first words - "You people repent and you will be accepted by God" were in Arabic. He concerned parents believed him to be disturbed by "demons" and called pastors to pray for the baby.

Eventually Muslim neighbors interpreted their son's alien speech and his parents later converted to Islam themselves. Although his father died in 1997, his mother remains in Tanzania while her worldly son continues his travel.

His entourage has been quick to produce videos of the high-pitched sermons. He has also been deemed genuine by Kenya's Muslim World League.

Kaplich Barsito, 35, from Nairobi, saw Shariff in action addressing a crowd of more than 1,000 in an open area of the Pumwani districts of Kenya's capital, and is in no doubt of the boy's abilities.

"He was like a politician, very confident," he said. He seemed as though he would have been disappointed if there had been less people.

The power went off and his minders wanted him to stop, but he grabbed the loud-speaker and carried on in Swahili, English and Arabic. It was very impressive and he mesmerized the audience with a focused sermon."

Shariff himself seemed mystified about his powers. He said last week that he picked up languages as soon as he heard. "I went to Congo and heard people speaking Lingala (the local language). I just was able to start speaking it."
Source: "Scotland on Sunday, August 8, 1999.

Watch his performance

http://video.google....4...993&q=allah
This is a true miracle of Islam , Sheikh Sharifuddin Al-khalifa (Shariff Idd) was born in a Christian family but was a Quran-hafiz at the age of 1 1/2 years of age and was praying 5 times a day.
 
Amazingly Sheikh Sharifuddin speaks in many languages, and with his speech has brought many many people to accept Islam.
 

If you have kids I suggest you send them to Islamic Schools of the best Akeeda, such as the ones on this website:

Tales of the Prophets (Qisas Al-Anbiya) (Great Books of the Islamic World) (Hardcover)

~ Muhammad Ibn Abd Allah Kisai (Author), Wheeler M. Thackston (Author), Al-Kisai (Author) "The learned and venerable scholar Muhammad ibn Abdullah al-Kisa'i has said:" Praise be to ALLAH, who has caused creatures to germinate as living organisms"

stopkillingtreestomakefakechristmastrees.jpg

 
Animals recite Quran, and say: ALLAH
 

If your living in North America, Click on this link to confirm in your mind the Qibla is SOUTH-EAST, according to Shaykh Al-Azhar!

sayidsalawat.jpg


  Shaykh Mohammed Yaqoob AlHasani's student, Shaykh Faisal, hoped people would show up in the Masjid to pray the Salaat for Solar Eclipse, many people didn't  even know about it.
 
He advised me to place his link on my site, I suggested he translate Arab Hizbs(Prayers into English. below is his link:
 
Habeeb Omar bin Hafidh uses Imam Ghazali's book: Marvels of the Heart during his lessons, I bought my copy from Amazon.ca, below is the link:
 
 
 
The Correct South-East Kiblah can be determined by the brilliant Lebanease of A.I.C.P, they must be blessed by the prayer of Hadruth Yusuf bin Isma-eel An-Nabhani RahmuthALLAH Alaih
 

imambusary.jpg

 Check out this Powerful Qasida, I wish to read both in english and arabic oftenly as time permits, inShALLAH: "Qasida Mudariyyah"

http://deenislam.co.uk/alMudariyya.pdf

Qasida Mudariyyah  by Hadruth-Imam Busairi Rahmuth-Allah Alaih

Mawlah ya Salli wa sallim daiman abadan 'Ala Habibika Khayril khalqi kullihimi

O Allah, send blessings upon the Chosen One al Mukhtar from the tribe of Mudar and upon the messengers and all the prophets that have been previously mentioned.

And send blessings, O my Lord, upon the Guide and his followers, and upon his companions who spread to maintain the religion.

They fought with him, and strove for Allah, migrated and sheltered him and were thus victorious.

They clarified the obligations (fard) and the Sunna, sought refuge in Allah and thus triumphed.

May it be the purest, most flourishing and most noble blessing, one that fragrances the universe

Diffusing the pure fragrance of musk and from it's fragrance may the scent of pleasure spread.

May it be multiplied by the number of stones, the grains of soil and sand, followed by the stars in the sky, and the vegetation on the earth,

  And by the weight of the mountains, followed by the drops of water and rain,

May it be multiplied by the number of leaves that the trees hold, and every letter ever to be uttered, read and scribed,

And (by the number) of beasts, birds, fish and animals, followed by the jinn, the angels and humans.

And by the number of atoms, ants and all the grains, and also by the number of hairs, wool, feathers and fur,

And by the amount of knowledge that Allah encompasses, and by what the Pen of decree and destiny has written

And by the number of all the blessings that Allah has bestowed upon the creation from the time of their creation to the time of their resurrection,

And by the magnitude of the Sublime that honoured the prophets and the angels and gave them glory,

And by the number of all things in the universes, O my Helper, and by everything that will be until the horn blows.

And with every blinking of the eyes of the people in the heavens and the earth, and in the moments of stillness,

And (multiply) by everything that the heavens and the earth contain including the mountains, and the lands, the Throne, the Footstool and whatever they encompass,

And may the blessings be by the number of what Allah has not created and by the which He has created with a continual blessing that does not end.

May it encompass the number of all things that have passed throughout the ages.

May it have no end or limitation, O Great One, nor a period that is concluded or contained.

And double the amount of what has ever been enumerated, doubled (again) and multiplied, O the One Who is Most Able.

(and send blessings) with peace, by the number of all that has been mentioned, my Lord, and multiply it, so that the blessings are spread far and wide.

And may it be multiplied by Your worth and by the breaths of Your creation whether it be much or little.

O my Lord, forgive all those who recite it, listen to it and all the Muslims wherever they may be.

And forgive our parents, our families and our neighbours, and all of us, O Master, we are in need of Your forgiveness.

I have come with sins that are innumerable, but Your forgiveness does not end or perish.

And with grief that occupies me from all that I aspire to, and I come with humility and heartbroken,

I beg You, O Lord, in both Worlds to have mercy on us, by him in whose hands the stones glorified (Allah)

O Lord, increase the good (favours upon us) and forgive us, for indeed Your Generosity is an ocean unlimited,

And alleviate the anxieties of a distressing nature, and relive us of sorrow, You are most Able.

And be kind with us in every calamity, with a beautiful kindness by which distress is no more.

By the (honour) of Mustafa, the Chosen one, the best of creation. In his praise, the chapters of (the Qur’an) were revealed.

And blessing be upon the Chosen one for as long as the sun rises and the moon shines.

And may (Your) pleasure be upon Abu Bakr, his khalifa, who maintained the religion after him victoriously,

And upon Abu Hafsa, al Faruq, his companion Umar who had the final word by his judgement.

And grant generously to Uthman the possessor of two lights, whose good qualities were accomplished with victory in both abodes.

And likewise to Ali with his two sons and upon their mother, the people of the mantle as has been related in the Hadith.(Hadith Al-Kisa)

And also upon our Sayyida Khadija al-Kubra who spent her wealth for the Messenger of Allah to gain victory.

And upon the pure wives of Mustafa, and also upon his daughters and sons whenever they are mentioned.

And upon Sa’d and Sa’id son of Auf, Talha, Abu ‘Ubayda and Zubayr, Masters of the best (of people).

And upon Hamza and our Master ‘Abbas, and upon his son, the scholar through him obscurities were no more.

And upon all the family and companions and followers. For as long as the dark night covers the day, and dawn appears.

With Your pleasure, pardon and well being and a good ending, when the term approaches. (Ameen)

Ara'Is Al-Majalis Fi Qisas Al-Anbiya,
 or known as: Lives of the Prophets
 
The Book by Ahmad Ibn Muhammad Tha'Labi, William M. Brinner; Brill, 2002. 774 pgs., seems to be an excellent source of understanding the Previous Prophets and Scriptures based on the Islamic Perspective, however Allahu Alim if it is 100% authenticly truthfull.  Check it out , clicking down at: http://www.questia.com/PM.qst?a=o&d=114636690
 
 We Should Purchase it in the near future, inShAllah God-Willing!

Sheikh ul Akbar Muhiyudin Ibn al Arabi RamathAllah Alaih stated that the Seal of Saints is like the seal
of Prophets, and was in existence from pre-eternity when Hudruth Adam (alai Salaat wa Salaam) was
between clay and water.  He also stated that the internality or the inward aspect (batin) of the Seal of Saints is the same as that of the Prophet Muhammad (SalAllah Walahee wa Salim) and that all spiritual knowledge come to all other Prophets and Saints through the channel and mediumship of the Seal of Saints.( Which is Hadruth -Shaykh Al-Akbar )

 Dear Sunni Shiyook,
 Doesn't my spiritual Brother Hadruth SHAYKH AL-AKBAR Muhiyideen ibnay Arabi al-Hatimi RahmuthAllah alaih say:
 
 Imam Mahdi (A) is the son of Imam Hasan Al-Askari (A)
 in Chapter 366 of the Meccan Revelations: Fatuhat Al-Makkiyah?

Know that when the earth will be filled with tyranny and injustice the Mahdi will rise and fill the earth with justice and equity. He will being from the descendants of the Prophet(A) and from the line of Fatimah(A). His grandfather being al-Husayn(A), and his father being Imam Hasan al-Askari(A), the son of Imam Ali an-Naqi(A), the son of Imam Muhammad at-Taqi(A), the son of Imam Ali ar-Rida(A), the son of Imam Musa al-Kadhim(A), the son of Imam Jafar as-Sadiq(A), the son of Imam Muhammad al-Baqir(A), the son of Imam Zayn al-Abedeen(A), the son of Imam Husayn ibn Ali ibn Abi Talib(A)."
-Futuhaat al-Makkiyyah, Section 366

Anyways, I've read edited verions are being printed now, and this is not a big suprise if that is the case. In Yusuf Ali commentary has been edited to take away what was said about Hassan (A) and Hussain (A). But at this point, I don't know whether the line I quoted has been added or whether it's been deleted.

If you can ask your Shaykh about this, it would be appreciated. If there are different versions out there, please inform me, I want to get to the bottom of this.
 
Assalam Walaykum, (sorry for the late reply)

First, the line about the first of creation is there in Futuhat Makiyya including the mentioning of Ali (ra). I don't find this to be against the validity of Khilafa of Abu-Bakr after the prophet (saaws) though. We also believe that Ali (ra) will have an intercession in the judgment day, but a minor intercession since the great intercession is only preserved to the Prophet (saaws).

Second, the line about Mahdi being the son of Al-Askari is NOT there -- at least in the (electronic) version I have.

Third, here is what it says about the innward (batin) khilafa and outward (zahir) khilafa: (I assume you read Arabic)

الأقطاب وهم الجامعون للأحوال والمقامات بالأصالة أو بالنيابة كما ذكرنا وقد يتوسعون في هذا الاطلاق فيسمون قطباً كل من دار عليه مقام ما من المقامات وانفرد به في زمانه على ابناء جنسه وقد يسمى رجل البلد قطب ذلك البلد شيخ الجماعة قطب تلك الجماعة ولكن الأقطاب المصطلح على أن يكون لهم هذا الاسم مطلقاًمن غير إضافة لا يكون منهم في الزمان إلا واحد وهو الغوث أيضاً وهو من المقربين وهو سيد الجماعة في زمانه ومنهم من يكون ظاهر الحكم ويحوز الخلافة الظاهرة كما حاز الخلافة الباطنة من جهة المقام كأبي بكر وعمر وعثمان وعلي والحسن ومعاوية بن عبد العزيز والمتوكل ومنهم من له الخلافة الباطنة خاصة ولا حكم له في الظاهر كأحمد بن هارون الرشيد السبتي وكأبي يزيد البسطامي وأكثر الأقطاب لا حكم لهم في الظاهر

So according to this, AbuBakr was Qutb during his Khilafa, then Omar, Othmaan, Ali, then Al-Hasan, ... etc. And these have got the innward khilafa as well as the outward khilafa.


Finally, one of the things that made me sure that Shia didn't tamper Al-Futuhat Al-Makiyya is the following quote:

ومنهم من يبقى عليه في سائر السنة أمر ما مما كان يكاشف به في حاله في رجب ومنهم من لا يبقى عليه شىء من ذلك وكان هذا الذي رأيته قد أبقى عليه كشف الروافض من أهل الشيعة سائر السنة فكان يراهم خنازير فيأتي الرجل المستور الذي لا يعرف منه هذا المذهب قط وهو في نفسه مؤمن به يدين به ربه فإذا مر عليه يراه في صورة خنزير فيستدعيه ويقول له تب إلى الله فإنك شيعى رافضي فيبقى الأخر متعجباً من ذلك فإن تاب وصدق في توبته رآه إنساناً وإن قال له بلسانه تبت وهو يضمر مذهبه لايزال يراه خنزيراً فيقول له كذبت في قولك تبت وإذا صدق يقول له صدقت فيعرف ذلك الرجل صدقه قي كشفه فيرجع عن مذهبه ذلك الرافضى ولقد جرى لهذا مثل هذا مع رجلين عاقلين من أهل العدالة من الشافعية ما عرف منهما قط التشيع ولم يكونوا من بيت التشيع أداهما إليه نظرهما وكانا متمكنين من عقولهما فلم يظهرا ذلك وأصرا عليه بينهما وبين الله فكانا يعتقدان السوء في أبي بكر وعمر ويتغالون في على فلما مرا به ودخلا عليه أمر بإخراجهما من عنده فإن الله كشف له عن بواطنهما في صورة خنازير وهي العلامة التي جعل الله له في أهل هذا المذهب وكانا قد علما من نفوسهما أن أحداً من أهل الأرض ما اطلع على حالهما وكانا شاهدين عدلين مشهورين بالسنة فقالا له في ذلك فقال أرا كما خنزيرين وهي علامة بيني وبين الله فيمن كان مذهبه هذا فأضمرا التوبة في نفوسهما فقال لهما إنكما الساعة قد رجعتما عن ذلك المذهب فإني أرا كما إنسانين فتعجبا من ذلك وتابا إلى الله
http://www.microsofttranslator.com/

This was a description of one type of Awliya and how they can identify a shia person and ask him to repent.

However, since in your version, you have got a line about Al-Mahdi being son of Al-Askari, it would be plausible that Al-Futuhat Al-Makiyya was tampered with by both Shia and Sunni so that every group wanted to make Ibn-Arabi looks like he is one of them and hate the other.

I said before that if Al-Futuhat Al-Makiyya was tampered, it is effectiveless. The reason for this is that Ibn-Arabi's books are in a field called "Khowledge of realities" (Uloum Al-Haqaaeq) and this is something hard to be tampered with since it cannot be understood by general people. The kind of tampering that could happen is in things like historical events or some politial positions like sunni or shia stuff.

Know that Mahdi (Allah be pleased with him) must appear but he will not appear till the world becomes full of tyranny and injustice, then he will fill it with justice and equity: and if there were no more than one day remaining from the life of the world, Allah would elongate that day to enable this Khalifah to rule, and he (Imam Mahdi) is from the progeny of the Messenger of Allah (blessings and peace from Allah be upon him), from the children of Fatimah (Allah be pleased with her): his forefather is Husain, son of Ali bin abi Talib; his father is Hasan al Askari, son of Imam Ali an Naqi, son of Muhammad at Taqi, son of Imam Ali ar Riza, son of Imam Musa al Kazim, son of Imam Jafer as Sadiq, son of Muhammad al Baqir, son of Imam Zain ul Abidin Ali, son of Imam Husain, son of Imam Ali ibn Abi Talib. His name is the name of the messenger of Allah (i.e Muhammad). the muslims will do his bayat between rukn and maqam; he will be like the messenger of Allah in appearence and below him in character because nobody can be like the messenger of Allah in character as Allah has said: verily thou art on great character. he will distribute wealth equally and will do justice to the public. help (from Allah) will precede him: he will follow the foot steps of the messenger of Allah and he will commit no mistake, there will be an angel supporting him though he will not see him ....

Al futuhat al makiyya, chapter 366,
 
I  Syed Safe-u-deen suggest that this awesome encylopedia should be translated completely 100%ly,  word by word from the original arabic script into our english language, inShAllahutalah 
 
 
We Shall find out by the Destiny of time, if this is indeed the Truth.
RUBBI ZIDNEE ILMUN! Ameen!!!
 ALLAHU-ALIM, HE KNOWS THE BEST WHO IS RIGHTLY GUIDED

sheikh_nur_hussein_shrine.jpg

Sheikh Nur Hussein Rahmuth Allah Alaih came from Baghdad to Ethopia, being blessed by the Spirit of Ghawthal Adham his Holiness Shaykh Nur KarmAllahu Wahju established a Masjid for the benefit of Ethopians.  He's the Grand-Shaykh of Abu Ghadah NafunALLAHobee!!!
Sheikh Hussein Shrine is an important symbol of Ethiopia’s history and religious diversity; a lasting symbol of the pluralist and tolerant version of Islam traditionally practiced in Ethiopia.
 
Peeranay-Peer  Dasta-geer Abdul Qadir Jilani  al Hasani Rahmuth -Allah  alaih Salaam can help both the living and the dead, view this Qawali to understand one of his helping miracles, when a sister murdered her brother. http://www.youtube.com/watch?v=rcGtdJ16z0g&feature=related

al-baz.jpg

ghauthalazmasdargahlookingbeautifull.jpg


Shrine of Ghawth al A'zam (Baghdad Shareef)
Radi Allahu ta'ala anhu


All Praise be to ALLAH who granted my the Ziyarah -(Visit)  
 Inside the Blessed Shrine of GhawthulAlAdhaam KarmAllahu Wajhu

myattemptatmodellingforhmiin94.jpg
meinmyyouth.jpg

hasbirabbi.jpg

niceislamiccallighraphy.jpg

HUDRUTH SAYEDEENAL KUTABAL KABEER BAAAZ-ALLAHU ASHAB- ABDUL QADIR AL-JEYLAANI QUDDUSS-ALLAHU WA SIRAHU AZEEZ

Sayyidina Muhyiddeen Sultaanul Ree-jaali Abu Muhammad Abu Abdur Razaq - Abdul Qadir al Jeylaani alaih Salaam was most likely born on the Night of Power (hence his name, Abdul Qadir), during Ramadan in 470 A.H. (1077 A.D.). He was born in Nayf in Jeylan, Persia. He passed to the other side at the age of 91 on the eleventh of Rabi al-Thani, 561 A.H. (1166 A.D.).

His blessed tomb is in Baghdad, where we should strive to provide Langaar for the poor daily inShAllahutalah if we can afford it.

His father is Sayyid Abu Salih Musah Jungi Dosti R.A and his mother is Ummul Khayr Fatima bint al-Shaykh Abdullah Sumi. R.A. Both of his parents are Sayyids (descendants of the Prophet, S.A.W), his lineage is called the Silsiletil Zehep (the Golden Chain).

Abdul Qadir al Jeylaani alaih Salaam is known as the Gawthul Azam (the Perfect Supreme Helper of ALLAH, the human being who has reached the highest possible level ), the Pole of Power, Qutbay Rabbani (the Divine or Devout Qutb), Sultanul Awliya (King of the Saints), QUTABUL-AZAM (the Greatest Qutb) and as the biggest helper of people in need. He was also known as BazAllahu Ashaab (the Grey Hawk).

When he was ten years old, his mother told him a story. "One day many years ago, I was traveling in the desert. A Bedouin in black clothing blocked the road I was on and attacked me. At that time, I started screaming for help. Suddenly, out of no where, a big hawk appeared, attacked the Bedouin, and kept attacking until the Bedouin fled. After that, it grabbed my headcovering and disappeared into the sky.

 I still wonder about this bird." Hazrath Abdul Qadir alaih Salaam smiled, and left his mother. A few moments later, he returned with his mother's headcovering and said "Mother, here is your headcovering. That bird you saw was me."

Mention of our RUBB'S name, combined with Durooday-Shareef- Salawaat, like Durooday Taj listed below:
O Allah, send blessings and Peace upon our Master and Patron Muhammad,
The Owner of the Crown and the Ascent and the Buraq and the Standard,
The Repeller of Affliction and Disease and Drought and Illness and Pain.
His name is written on high, served and engraved in the Tablet and the Pen,
The Leader of All, Arabs and non-Arabs,
Whose body is sanctified, fragrant, and pure,
Illumined in the House and the Haram,
The Sun of Brightness, the Full Moon in Darkness,
The Foremost One in the Highest Fields, the Light of Guidance,
The Cave of Refuge for Mortals, the Lamp That Dispels the Night,
The Best-Natured One, The Intercessor of Nations,
The Owner of Munificence and Generosity.
Allah is his Protector, Gabriel is his servant.
The Buraq is his mount, the Ascent is his voyage,
The Lote-Tree of the Furthermost Boundary is his station,
Two Bow-Lengths or Nearer is his desire,
His desire is his goal, and he has found his goal,
The Master of the Messengers, the Seal of the Prophets,
The intercessor of sinners, the friend of the strangers,
The Mercy for the Worlds,
The rest of those who burn with love, the goal of those who yearn,
The sun of knowers, the lamp of travellers,
The light of Those Brought Near,
The friend of the poor and destitute,
The master of Humans and Jinn,
The Prophet of the Two Sanctuaries,
The Imam of the Two Qiblas,
Our Means in the Two Abodes,
The Owner of Qaba Qawsayn,
The Beloved of the Lord of the Two Easts and the Two Wests,
The grandfather of al-Hasan and al-Husayn,
Our patron and the patron of Humans and Jinn:
Abu al-Qasim MUHAMMAD Son of `Abd Allah,
A light from the light of Allah.
O you who yearn for the light of his beauty,
Send blessings and utmost greetings of peace
Upon him and upon his Family.                           
before mentioning my name to the owners of these fine companies, shall bring ALLAH'S mercy in your life!, leading them to give you a discount  inshALLAH!( The Main owner and founder of Lifelong Furniture, Alum Geer Uncle has passed away unexpectedly, May ALLAH have Mercy on his soul as he showered mercy on the soul of my Maternal Grandfather  Hadruth Imam Ali Raza RahmuthAllah -Alaih KarmAllah Wajhu alaih Salaam,
(My Grandmother Ruqia Begum bintay Shaykh-Al Islam Mawlaana Muhammed BadaShah Hussaini NafunALLAHu-bee was descendant of Hyderbad's famous Wali: Khajah MehboobAllah Ramuth Alaih Alaih who in turn wa decendant of Imam Ali Raza KarmAllahu Wajhu Rahmuth-Allah Alaih Salaat wa Salaam)
 
May ALLAH asavajal make us live today, remembering we shall die tommorrow, hopefully in the same manner as our beloved Imam Ghaa-zaali RahmuthAllah alaih, inShALLAH is what I say!, Ameen
Checkout out this link today!
 

http://www.al-baz.com/ourbooks.shtml

The Babri Masjid was a Masjid in Ayodhya, it was destroyed by  a group of 150,000 unjust people who call themselves Karsevaks & Hindus during a planned ceremony on December 6, 1992 despite a commitment to the Indian Supreme Court that the Masjid would not be harmed. More than 2000 people were killed in the ensuing riots following the demolition. Riots broke out in many major Indian cities including Mumbai & Delhi etc.

Liberhan Commission headed by the retired judge of Supreme Court  M S Liberhan  was constituted on Dec16th, 1992 by an order of the Indian Union Home Ministry following the demolition of the Babri Masjid in Ayodhya on 6 December and the riots in Ayodhya. The Commission was expected to submit its report within three months. After a delay of 17 years, the commission submitted the report to the Prime Minister of India Dr. Manmohan Singh on 30 June 2009.  On 23 November 2009, the report leaked to the media. There was an uproar in the Lok Sabha. The opposition blamed the Home Ministry for deliberately leaking the report. The Parliament session had to be adjourned on the same day. The Government assured to table the report with an ATR(Action Taken Report) during the winter session of the Parliament.

The one-man panel, one of the country’s longest running inquiry commissions cost the government Rs.8 crore wrote the report on the sequence of events leading to the razing of the Babri mosque by Hindu mobs on Dec 6, 1992.

Sources told IANS that besides identifying those who played a role in the destruction of the 16th century masjid, the commission would also unravel why and how the demolition happened and name the larger forces and actors responsible for it.

Appointed by former prime minister Late. P.V. Narasimha Rao two weeks after the demolition on Dec 16, 1992, to ward off criticism against his government for having failed to protect the masjid, the commission in August 2005 finished hearing its last witness Kalyan Singh — who was Uttar Pradesh chief minister at the time of the demolition and was dismissed soon after.

In 16 years of its proceedings, the commission recorded statements of several politicians, bureaucrats and police officials including Kalyan Singh, late Narasimha Rao, former deputy prime minister L.K. Advani and his colleagues Murli Manohar Joshi and Uma Bharati as well as Mulayam Singh Yadav.

Top bureaucrats and police officials of Uttar Pradesh, the then district magistrate R.N. Srivastava and Senior Superintendent of Police D.B. Roy of Ayodhya also recorded their statements on the demolition.

Even today people like Uma bharti, L.K.Advani etc are still insisting on the fact that a Ram Mandir should be constructed on the site. Are they human beings with sound mind and heart? They are playing on the top of confused masses. People who disturb a thing already in order and destroy PEACE  are TO BE STOPPED.

I know what tells the Hindu religion- its only attempt is PEACE. May be Hinduism differs from Islam on various concepts but both attempt to achieve Peace.

This is not HINDUISM.

updated on 24.11.09 : The Liberhan Commission has held 68 people individually culpable for leading the country ‘to the brink of communal discord’. The list includes former prime minister Atal Bihari Vajpayee, senior BJP leaders L.K. Advani and Murli Manohar Joshi as well as Shiv Sena chief Bal Thackeray.

Amongst the others in the list are then Uttar Pradesh chief minister Kalyan Singh, Vishwa Hindu Parishad leaders Ashok Singhal and Pravin Togadia, RSS chief K.S. Sudarshan as well as Govindacharya, the late Vijayaraje Scindia, Vinay Katiyar, Uma Bharti and Sadhvi Rithambara.

Bureaucrats have been named too, including A.K. Saran, inspector general (security) and chief secretary V.K. Saxena.

This is an extract from IMAM JAFER IBN HASAN AL-BARZANJI  Rahmath Alah alaih's Super-Qaseedah 

The Barzanji Mawlid: The Jewelled Necklace of the Resplendent Prophet's Birth by Hadruth Jafer ibnay Hasan Al-Barzanji KarmAllahu Wajhu- RahmuthAllah Alaih wa Salaat wa Salaam:

Yaa Nabi Salaam 'alaika
Yaa Rasul Salaam 'alaika
Yaa Habib Salaam 'alaika
Salawaatu'llah 'alaika

Salutations on you, O Prophet
Salutations on you, O Messenger of Allah
Salutations on you, O Beloved
Blessings of Allah be upon you.

Ashraqa'l Badru 'alaina
Fakhtafat Minhu'l Buduru
Mithla Husnika Maa Ra'aina
Qattu Yaa Wajhas-Suroori

Anta Shamsun Anta Badrun
Anta Noorun Fawqa Noori
Anta Ikseerun wa Ghaali
Anta Misbaahu's-Sudoori

Yaa Habibee Yaa Muhammad
Yaa 'Arusa'l Khaafiqayni
Yaa Muayyad Yaa Mumajjad
Yaa Imama'l Qiblataini

Man-ra'aa Wajhaaka Yas'ad
Yaa Kareem al-Waalidaini
Hawdhuka's-Saafi'l Mubarrad
Wirdunaa Yawm an Nushoori

A full moon rises over us
The other moon disappears
We never saw the like of your beauty
O face of gladness

You are the sun, you are the moon
You are light upon lights
You are gold and even more priceless
You are the light of hearts

O my beloved, O Muhammad
O star of east and west
O supporter, O praised one
O leader of both Qiblas

Whoever sees your face, gets happiness
O the kind one to both parents
Your clear and cool fountain
Is our goal on the Day of Reckoning

LOVE ALLAH ABOVE ALL THINGS AND SEEK FORGIVENESS FROM HIM Allahoo JALA-JALAALAHOO

Best Regards, from your's

 TRU-ALI

Syed Safe-ud-Dean Ali Khan Al-Qadiri Al-Jilani Al-Hasani

 Seeking Allah’s Forgiveness

Forgiveness is being shielded from the harmful consequences of wrong actions, and the veiling of them. Seeking forgiveness is mentioned again and again in the Qur’an, and in some places it is a command, as in His saying, Glorious and Exalted is He:

"And seek forgiveness of Allah; surely Allah is Forgiving, Compassionate."

(Qur’an 73:20)

In other places, Allah praises those who seek his forgiveness, as in the ayat:

"And those who pray for forgiveness in the early hours of the morning."

(Qur’an 3:17)

In other places, Allah tells us that he forgives those who ask for His forgiveness, as in ayat:

"And whoever does evil, or wrongs his own soul, but afterwards seeks Allah’s forgiveness, will find Allah is Forgiving, Compassionate."

(Qur’an 4:110)

Seeking forgiveness is frequently associated with repentance, in which case it takes the form of asking for forgiveness with the tongue. Repentance is turning away from wrong action with both heart and body. Seeking forgiveness is similar to supplication in that Allah, if He so wishes, responds to it and forgives the person who seeks His forgiveness. This is especially true if the du’a (supplication) came directly from a heart troubled by wrong actions, or if it was made during the times most favorable for His response, such as in the early hours of the morning or immediately following the prayer.

It has been transmitted that Luqman once told his son, "O my son, make it a habit for your tongue to utter the words, ‘Forgive me, o Allah’ for there are certain times during which Allah will not disappoint a servant who calls on him."

Al-Hasan said "Ask for Allah’s forgiveness frequently- in your homes, at your tables, on your roads, in your markets, at your meetings, wherever you are. You never know when you will be granted His forgiveness.

Abu Huraira reported that the Prophet (saws) said:

"I swear by Allah that I supplicate for Allah’s forgiveness and turn to Him in repentance more than seventy times a day."

Al-Bukhari,kitab ad-Da’awat 11/101

Abu Huraira said, "I heard the Messenger of Allah (saws) say, ‘A servant committed a sin and he said, "O Allah, I have committed a sin, so forgive me." Allah said, "Does my servant know that he has a Lord who forgives sins and helps him? I forgive my servant." After some time, the man committed another sin so he said, "O my Lord, I have committed another sin, so forgive me." His Lord said "Does my servant know that he has a Lord who forgives sins and helps him? I forgive my servant." After some time the man committed yet another sin so he said. "O my Lord, I have committed another sin, so forgive me." His Lord said, "Does my servant know that he has a Lord who forgives sins and helps him? O servant do what you like, I have granted you forgiveness."

Al-Bukhari, kitab at-Tawhid, 13/488; Muslim

Allah Exalted is He, said this three times.

This means that the man was granted forgiveness because he continued to seek Allah’s forgiveness each time he committed a sin. It appears that this is applied so long as his seeking forgiveness was not accompanied by the intention to repeat the sin again afterwards.

Aisha, May Allah be pleased with her, said:

"It is a fortunate person who (on the Day of Judgement) finds in his record many du’as (supplications) for forgiveness."

In other words, seeking Allah’s forgiveness is a cure for all wrong actions.

Qatada said:

"This Qur’an guides you to the recognition of your illnesses and to their remedies. Your illnesses are your sins and your medicine is seeking Allah’s forgiveness."

Ali ibn Abi Talib, may Allah be pleased with him, said:

"Allah does not inspire seeking forgiveness in any servant whom he wishes to punish."

Reference: The Purification of the Soul

beehivebrown.jpg

 
 
 
 
 
 
JA AL HAQ : The Obliteration of Falsehood (NEW : 2nd Edition

  Hardback - 600 pages     [ ENGLISH ]       by Mufti Ahmad Yaar Khan Na'imi Ashrafi alayhir rahman  

 
Translated into English:  by Mawlana Omar Dawood Qadiri Mu'ini

ABOUT THE BOOK: The Obliteration of Falsehood is an English translation of Hadrat Mufti Ahmad Yaar Khan Ashrafi's Allah be pleased with him celebrated Ja 'al-Haqq
, one of the most complete, recognised and irrefutable works on proving the practices and beliefs of the Muslim Ummah for the questions raised in the modern era.

In an age wherein an increasing number of individuals believe they have the right and power to deduce the fundamentals of Islam based on a superficial understanding of the Qur'an and Hadith, Ja 'al-Haqq stands tall as a testament to the unsurpassed examinations and watertight judgements produced by the eminent researchers in the history of Islam.

Why are Muslims Hanafi, Shafi'i, Maliki & Hanbali? Why do they celebrate the birth of the Beloved Prophet
Salla Allahu ta'ala 'alayhi wa Sallam ? What is the need to use the Prophet Salla Allahu ta'ala 'alayhi wa Sallam as mediation to Allah Subhanahu wa Ta'ala when Allah Subhanahu wa Ta'ala is constantly with us? The pen of Mufti Ahmad Yaar Khan Allah be pleased with him, leaves no stone unturned in answering these and many other objections currently forwarded to the traditional, Sunni Muslims of our age, confirming that Sunni Islam is still the only path founded on the Qur'an & Sunnah and demonstrating why it remains followed by the largest group of Muslims in the world.----Sayyad Muhammad Aleem ud-Din Asdaq Misbahi Aazmi (Founder, Rector & Principal of Darul Uloom Qadria Ghareeb Nawaz, Ladysmith, South Africa).
 

Contents:
 
Foreward, About the Author, About the book, Translator's Note, Introduction, Preface,
Taqleed
 - Following the Four Imams,
The Prophets'
Peace be upon him 'Knowledge of the Unseen' (Ilm-e-Ghaib),
 
Proofs of 'Knowledge of the Unseen'
Discussion on
Haazir & Naazir
,
Proof of
Haazir & Naazir,
 
Discussion on Calling the Beloved Prophet
Peace be upon him a ''man'' or ''brother''
 
Discussion on proclaiming or calling out,
''Ya Rasulullah''
(O' Messenger of Allah!)
Discussion on Innovation
(Bidat),
 
Discussion on Gatherings for
Mawlid (Meelad Shareef) - Celebrating the Birth of the Beloved Prophet
May Allah Bless him & Grant him Peace,
Discussion on the Standing (Salaami)
of Meelad,
Discussion on
Fatiha, after 3 days, 10 days & 40 days
,
Discussion on
Du'a after the Salaat al-Janazah
,
Discussion on Constructing Domes over graves (Mazaars) of the Awliya
(Freinds of Allah),
Discussion on placing flowers and sheets (
ghilaafs
) on the graves and brightening them,
Discussion on Reciting
Azaan
 at the graveside,
Discussion on the
Urs
 (Anniversary on the departure of a Saint)
Discussion on Making Journeys to Visit the Burial Paces (
Ziyarah of Mazaars)
of Saints
Discussion on Writing
Kafani or Alfi
 
Discussion on Reciting
 Zikr
Aloud
Discussion on Preserving Animals in the names of the Saints
(Awliya),
Discussion on Respecting Sacred Relics (Tabarukkat) & ''Kissing the hands' and 'feet of the Pious' Discussion on Keeping names like Abdun-Nabi
(Servant of the Prophet), Abdur-Rasul, etc,
Discussion on
Isqaat
(Reducing the responsibilties of the deceased)
Discussion on
Kissing the Thumbs during the Azaan
,
Discussion on Reciting Aloud the
Kalima or Naat Sharif whilst taking the Janazah
to the graveyard,
Deobandi Beliefs
& the Correct Islamic Beliefs
The Prophets
alayhim as salaam are Unable to Sin (Ma'sum
),
Proofs that the Prophets are Unable to Sin,
The
Taraweeh Salaah consists of 20 Rakaats
 
Discussion on Giving Three Talaaqs at once being Three,
The Importance of
Taqleed (Following the Four Imams Allah be pleased with them),
 
The Excellence of
Imam Abu Hanifa May Allah be pleased with him,
 
Discussion on
Decorating/Illuminating the Masajid
with lights, etc,
Discussion on
Shabeena
& it being a means of Reward
Glossary

This Book belongs in all Masjids and bookstores, to help us in eliminating the Fitna caused by scholars of  Najdee-Satin-ism who pretend to be the Salafi, just like the Shi-ite Shayateens do Tukiya pretending to be Sunnease and is in my opinion is a Necessity for Muslims of all backgrounds.   

(ALL PROCEEDS GO TOWARDS ACQUIRING FURTHER BOOKS AS WELL AS COVERING OUR WEB ADMIN COSTS )http://madanipropagation.com/

Our Price £23.95        INCLUSIVE OF UK DELIVERY ( They sent a copy to me via DHL, via me, paying by Paypal), However if you can convice them to contact my friend Mian Igbal of PILOT COURIER, he shall save you a great deal of money, inSHALLAH, below is his link:

http://www.pilotcourierltd.com/about.htm

 

 


Palestine Under Siege:
Urgently needed funds for food, fuel and medicine

In the early morning of 23rd January, over 350,000 Palestinians surged into Egypt from the Gaza Strip after parts of the border wall were destroyed. Hundreds of thousands of Gazans rushed over the border, some frantically searching for loved ones, most desperate for food and fuel. The chaos only highlights the extreme hardship endured by the Palestinian people. Approximately 1.5 million people are living under conditions of siege. Most are living well below the poverty line of US $2 dollars per day with little access to the basic necessities such as fuel, food, electricity and medicine.

Working in partnership with Interpal, Muslim Aid is asking you to make a difference to the lives of those isolated from the world by the conflict. We urgently need help in raising £5 million for the people of Palestine- for food, fuel and medical supplies.

£2million has already been allocated thanks to our emergency relief partners Global Medic and Interpal. Despite the difficulties, we pledge to get supplies to those most in need through local partners.

Muslim Aid | PO Box 3 | London | E1 1WP • +44 (0)20 7377 4200
Account number: 00997026
Sort code: 30-94-21
W: www.muslimaid.orgE: mail@muslimaid.org


Peace studies: Children of Israel

In a city marked by division, the Max Rayne school is unique – the only one in Jerusalem where pupils, principals and teachers are from Jewish and Arab communities. By Donald Macintyre

At first glance the class of excited nine-year-olds looks like any other when the principal drops in for a visit.

As their teacher, Yaffa Tala, writes each item on the blackboard her pupils shoot their hands up to specify what they hope will be in the brand-new school building that they will be moving into next month and will visit for the first time on a trip which Ms Tala explains will start at 8am today: a cafeteria (no); computers (yes); a proper playground (yes); drinks machines (for water, yes, for fizzy drinks, no); a library (yes); a gym (yes); individual lockers (yes).

"Will they have keys or codes?" one child asks. There's a murmur of approval when the principal, Ala Khatib, announces that there will be two lavatories for every class instead of the six for the whole school in the "temporary" building it has occupied for the last decade. There is a gasp of excitement when Moid Hussein in the back row asks him if there will be an elevator and the head says yes – changing swiftly to disappointment when he explains it will be not for Moid and his classmates but for the disabled, and for elderly visitors to the school.

But in fact these 36 fourth-graders are like no others in any school in Jerusalem. For a start, as in every class here, there are two teachers – sharing the lesson with Ms Tala, an Israeli Jew, is her colleague Rajaa Natour, a Muslim Arab. And then you realise that about half the class are Arabs (including three Christians) and the other half Jews, with Jews and Arabs, boys and girls, paired up on many of the desks.

The lesson itself is in two languages. It begins in Hebrew – with most of the Arab pupils speaking it fluently. When it switches to Arabic – at the suggestion of the principal – the Jewish children feel less comfortable asking questions in a language most of them have not quite yet mastered. But when Omri Bar Giora, wearing a bright blue Israel national team shirt says – in Hebrew – that he hopes there will be "four football fields" at the new school, the face he makes shows he has no difficulty whatever in understanding the principal when he explains, in Arabic, that, sadly, that would be a bit much to expect. "I make a point of never speaking in Hebrew in class," says Mr Khatib, a first-rate Hebrew speaker.

But this is not for the benefit of the Arab children, but for the Jewish ones, who he is anxious to see turn their good "passive" Arabic – the ability to understand – into the confidence and ability to speak it.

But then Mr Khatib is, in truth, not the principal, but one of two co-principals, the other being Dalia Peretz, a Jewish Israeli teacher (who incidentally learnt her Arabic from her Moroccan Jewish immigrant mother for whom it was the first language). And the two close colleagues are equally presiding over a unique and visionary educational venture, the only Jewish-Arab school in Jerusalem.

Any time now (when the Jerusalem municipality gives it the final permit) and thanks to a major donation from the Rayne Foundation, the charity set up by the late British Jewish businessman and philanthropist Lord Rayne, and other funds channelled through the Jerusalem Foundation from Germany, Switzerland, Liechtenstein and Austria, the Max Rayne School and its 406 pupils will move into its $11m (£5.4m) purpose-built premises.

The school is located on the border between the Jewish West Jerusalem neighbourhood of Pat and the Palestinian East Jerusalem neighbourhood of Beit Safafa from which many of the Arab pupils come. The official opening ceremony is on Sunday.

It is hard to overestimate the importance, pioneering rather than merely symbolic, of the school in a city whose religious and ethnic divisions are at the absolute heart of the Israeli-Palestinian conflict.

Two members of the fourth-grade class, Yazid Ershed, the Arab boy, who asked about the drinks machines, and Aviv Pek, the Jewish girl, who asked about the library, have grown up together in the school having been at the kindergarden together. Discussing what the school means to them yesterday, they completed each other's sentences several times. "I like the school and I really like the teachers," says Aviv. "I have lots of Arab friends. One of my best friends is an Arab girl and, of course, she comes to my house."

The point is echoed by Yazid: "I have Jewish friends too," he says. "We go to each other's houses. We play football, we play with computers or we just talk."

Conscious that outside the school Jewish and Arab children remain segregated, Yazid says: "If they all went to school together there would be no war. They would live next to each other in peace and not fighting each other." What did their friends from segregated school think about them coming here? "When I tell them I go to a Jewish Arab school, they are very surprised," says Yazid. "They don't understand it." Aviv recalls: "A woman who is a neighbour started shouting at my father: 'Poor girl, what is she going to learn from the Arabs?' She doesn't understand that Arabs have a life, they are nice people and not the monsters of the city."

Yazid explains that the school observes all the main religious festivals – the Jewish high holidays, the great Muslim festivals such as the Eid al Fitr just passed, and Christmas. Some of the holidays are shortened to ensure that the pupils are at school for as long as other children in the city.

And he adds: "Last year we studied all the religions together but this year each kid is learning about his own religion." In school, the children speak partly in English– which both are learning – but more in Hebrew, in which Yazid is fluent. So again, does Yazid speak Hebrew better than Aviv speaks Arabic? Aviv nods. Her Arabic is "not good enough". "But I am learning to speak it slowly," she adds. Yazid says of the school pupils in general: "If we speak in Arabic part of the kids will understand but if we speak in Hebrew all the kids will understand."

This asymmetry isn't hard to understand in a city in which the mainly Arab families whose children go to the school – most of whom have Israeli citizenship – deal every day with the many institutions of a city which has been under Israeli control since the 1967 Six-Day War. Arab children are much more likely to be exposed to Israeli entertainment and media than Jewish children are to their Arab counterparts and the principal attractions, such as the city zoo, to take a single example of many, are Israeli.

Improving the Arabic language skills of Jewish children, says Mr Khatib, who like Mrs Peretz, has two daughters at the school, is one of the challenges the school faces. As he points out, "no one told us" how to run a school with Jewish teachers teaching Hebrew to Arab children and vice versa.

Indeed the training, as Mrs Peretz, who happens to be the sister of the former defence minister and Israeli Labour leader Amir Peretz, is very much "in service". But the other challenge is to persuade the Israeli Ministry of Education, having fully accredited the school up to the ninth grade, to allow it to build the high school for which level the school's first pupils will be ready next year. The school is one of three across Israel in what is known as the "Hand to Hand" project – the others being in the Galilee and the northern Wadi Ara triangle of Arab towns and villages. The project's mission statement says that the growth and success of the schools already "testifies to the extraordinary power of a simple idea – that by coming together, face to face, Arab and Jewish children can study side by side, learning each other's languages and cultures" – in turn teaching "that our common humanity is more important than any differences that divide us".

So far, of course, many of the parents who have chosen the school are middle-class professionals. (Aviv's father is a business consultant; Yazid's a lawyer) But Mrs Peretz, who would like to see 10 "Hand to Hand" schools across Israel in the foreseeable future, says that the school is already making strides – partly through scholarships to cover the relatively modest £600 per year costs to families – in attracting more lower income families. Some residents of Pat, a lower middle-class Jewish neighbourhood, alienated from the ethos of the new school being built in their midst, have even held protest demonstrations. But the school is planning intensivediscussions with local community leaders, not least to persuade them to encourage local children to become pupils.

Meanwhile one of the school's many important functions is to confront both communities with the different, and indeed wildly contradictory, narratives of the other. To Israelis, 1948 is the victorious War of Independence and to Palestinians the Nakba, or "disaster", in which hundreds of thousands of Palestinians fled or were forced to leave their homes. That can be painful for Jewish as well as Palestinian pupils.

"Some of them feel guilty saying 'Did my people really do what you are saying'," says Rajaa Natour. "Others feel very proud of their state. In one class a kid got up and said 'We won the war'."

Such a statement, she explains, then provoked a deep discussion about what that victory meant. Ms Natour adds that she works in the school because it "is a very leading project and this may be the only place to make education a tool for change".

And, as Ms Peretz points out, the Jewish parents have already signed up, before their children come, to a school "ideology" which provides for such debate. One parent, an Israeli photographer, Quique Kierszenbaum, who took the pictures for this article and who serves on the school parents' committee, sums up why he and his wife, Sharon, wanted his five-year-old son, Guili, at the school. "We are a very liberal family and we feel that normal schools in Jerusalem have an atmosphere of not knowing anything about the others who live in this city," he says. "For us after six or seven years of the intifada the school seemed like the only solution to staying in this place.

"If you are not part of the solution you are part of the problem and we want to be part of the solution."

This, he believes, translates "into normal life in a way that is easy and natural". Whether it is the pleasure his son has taken over the last month of greeting everyone he meets, Jews and Arabs, with the seasons-old Arab greeting Ramadan Karim, or the Arab and Jewish intensive and free-ranging parents' discussion about how exactly to commemorate the 12th anniversary next week of the assassination of the Israeli premier Yitzhak Rabin by a right-wing fanatic, there is more emphasis on the discussion of democracy, peace and non-violence, and less on mere ceremony.

"We are living co-existence here, not just dreaming or talking about it," says Mr Kierszenbaum. "We're giving to it the most important thing we have –the education of our sons and daughters."

One of the school's newest pupils is Maria Amin, a six-year-old Palestinian girl from Gaza who is confined to a wheelchair which she navigates with a joystick operated by her chin. A patient at Jerusalem's remarkable rehabilitation hospital, the Alyn, she was paralysed from the neck down when the car she was travelling in was caught in an Israeli missile strike on an Islamic Jihad commander which killed her mother, uncle, grandmother and elder brother.

She wasn't at the school yesterday because of medical problems, but Mrs Peretz hopes she will be at the school for several years to come.

You can't miss, fixed to the door of her classroom, under inscriptions of greeting in Arabic, a colourful painting – a house a flower, a tortoise, a vivid rainbow – by her new classmates. In large letters on the painting are written the words"Welcome Maria". In Hebrew.


themessage.jpg

I really enjoyed watching Chuck Norris in INVASION U.S.A

Now it's time he should star in INVASION ISRAEL

Coward Israeli Settlers Attack Elderly Palestinian Couple

http://www.youtube.com/watch?v=Sp890nXTJ44


Israeli police-woman-officer was also beaten, injured by terrorist settlers

By MARK LAVIE, Associated Press Writer

JERUSALEM – Angry settlers beat and seriously injured a female Israeli
police officer Tuesday, police said, as she tried to enforce a
government ban on new housing construction in Jewish West Bank
settlements.

It was the most serious clash between settlers and authorities since
the building restrictions were imposed last month. Settlers have vowed
to defy the orders and have confronted government inspectors,
scuffling with them.

Police spokesman Gil Elhadad said about 100 settlers, most of them
teenagers, burned tires and blocked the entrance to the settlement of
Tsofit, in the northern part of the West Bank near the line with
Israel. He said some of them jumped the police officer and beat her,
breaking several ribs. She was taken to a hospital for treatment of
serious injuries, he said. He did not give her name or age.

Angelina Jolie and Brad Pitt's Gift to Iraqi Kids

Angelina Jolie and Brad Pitt have announced $1 million in donations for children impacted by the Iraq crisis, including $200,000 to help the IRC rehabilitate schools and provide catch-up classes for kids whose education has been disrupted by ongoing violence.

"These educational support programs for children of conflict are the best way to help them heal," said Angelina Jolie in announcing the donation. "We hope to encourage others to give to these great organizations," Brad Pitt added.

Photo, courtesy UNHCR: Angelina Jolie during a visit to Pakistan in her role as UNHCR Goodwill Ambassador.

Join Angelina Jolie and Brad Pitt
Donate now to help the IRC give Iraqi kids safe places to play and learn

Learn More
Read about the Jolie-Pitt campaign and how the IRC is helping restore school programs in Iraq

Click on this DargahPhoto to go to marriage Bureau
meathedargah.jpg
http://emeraldmountain.tripod.com/muslimmarriageforyou/

"TaqabbAllahu minna wa minkum " 
May Allah accept our and your good deeds.
"Kullu am wa antum bi-khair !.
May you and the whole world be well! inshaahALLAHutalah

Image by FlamingText.com

If you follow my advice on Salaat and are regular in making Towba (Seeking forgiveness), reciting Quran and proclaiming Salawaat!!!, ALLAH most mercifull, shall grant you Jun-naath!!!

Watch this JINN praying Salaat at:

http://www.youtube.com/watch?v=ouOXWgJS-gc


Amazing moment the world's biggest Christ was struck by lightning

Last updated at 00:34 13 February 2008

This was the dramatic scene as the world's largest statue of Jesus was hit by lightning.

The bolt parted the thunderclouds over Rio de Janeiro, Brazil, to strike Christ the Redeemer.

The statue is 130ft tall, is made of 700 tons of reinforced concrete and stands atop the 2,296ft Corcovado mountain overlooking the city.

Scroll down for more ...

christ statue

Heavens above: The statue is struck during Sunday's storms

Enlarge the image

It was named one of the new Seven Wonders of the World in 2007.

Sunday's storm caused havoc in Rio, felling trees in several neighbourhoods - but did not damage the statue.
Read more: http://www.dailymail.co.uk/news/article-513855/Amazing-moment-worlds-biggest-Christ-struck-lightning.html#ixzz0y6JddGJF

Mea Maxima Culpa: Silence in the House of God (2012)
In this photo released by Guatemala's Presidency on Monday May 31, 2010, a sinkhole covers a street intersection in downtown Guatemala City, Monday May 31, 2010.

In this photo released by Guatemala's Presidency on Monday May 31, 2010, a sinkhole covers a street intersection in downtown Guatemala City, Monday May 31, 2010.

See What Happens When ALLAH asavajal Gets Angry!

Anyone who wants protection, then ALLAH is enough for him.
Anyone who wants to model, then my Master- MUHAMMAD SallAllah walahee wa Salim is enough for him.
Anyone who wants to live in the guidelines, then the Quraan- Al-Kareem is enough for him.
Anyone who wants a warning, death is enough for him.
And whosoever was not enough with all that, then hell  is enough for him.

I hope all members of muslim terrorist groups don't just read the Quran, but also recite abundant Salawat on all the Prophets and watch your movies, So they may be granted the ability to reason that, although some Government officials may be friends of ShaaytaanirRajeem, ALL are definetly Not!!!

 https://www.youtube.com/watch?v=gzLjFfSmpuo

May ALLAH guide you and us, in such a way that, we try to judge our best in determining our fellow-humans on an individual basis, because we're all responsible, and accountable to ALLAH asavajal for our own deeds, on the day of Yawmil Qeeyaamah

- The Day of Judgement & Reckoning!

May HE(ALLAHU Jala Jalaalahu) forgive you and us, Ameen!

http://www.youtube.com/watch?v=s0FNckgqtlA&feature=related

CONFESSIONS OF A BRITISH SPY Paperback - 320 pages

A Must read for every Muslim! This book Confession by a British spy, translated from the book (Muzakkarat-ul Mister Hempher) which was puplished in Cairo by (Dâr-ul-kitâb-is-sufi), consists of the memoirs of Hempher, one of the thousands of spies (men and women), sent to islamic countries by The Ministry of the British Colonies, to demolish the Islamic faith.

In this confession, the spy, Hempher, disclosed the lies and slanders fabricated by the Ministry; how he had deceived Muhammad bin Abdul-Wahhab, the founder of
Wahhâbism;
how he had strived to divide Muslims into groups and to corrupt their religion.

 

Confessions of a British Spy | Best OnlineVersion!
www.freewebs.com/confessionsofabritishspy/

http://www.hakikatkitabevi.com/download/download.htm

wastingtimeisworsethandeath.jpg

All Praise and Glory be to ALLAH who sustains us, by the blessings and prayers of his Rasool SallAllah-Walahee-Wa-Salim, who was always against terrorism!.  Check out our FATWA! at:

Taliban and Sif-futhay-e-Sahaba’s attack on Eid Milad-un-Nabi SallAllahwalahee sa salim rallies!
Rescuers stand near a child injured by a firing, at a local hospital in Dera Ismail, Pakistan on Saturday, Feb. 27, 2010. According to police official unidentified gunmen opened fire on a procession celebrating the anniversary of the birth of Islam’s Prophet Muhammad SallALLAHwalahee wa Salim.

Abdul Nishapuri writes on the let’sbuildup Pakistan blog

The 12 Rabi-ul-Awwal is celebrated by Muslims in Pakistan as the birthday of the Prophet Muhammad (peace by upon him and his progeny). In particular, Sunni Barelvi Muslims organize large public meetings and rallies on that day in the memory of the Prophet.

It is however a known fact that certain Muslim sects (e.g. Wahhabi and Deobandi) term such ceremonies of the Eid Mila-un-Nabi as shirk (polytheism) and biddat (innovation in religion).

Everyone is entitled to their own interpretation and practice of religion as long as it does not lead to violence or hate speech. However, the situation gets ugly when some extremist element within one sect try to superimpose their interpretation of Islam and Quran on other sects through the use of violence.

This is exactly what happened in D.I. Khan and Faisalabad on the most sacred day of the birthday of the Prophet, when extremist Deobandis and Wahhabis belonging to Taliban and Sipah-e-Sahaba attacked peaceful public rallies of Barelvi Muslims. Scores of Barelvi Muslims were killed or injured in these two separate (but ideologically interconnected) incidents.

The question is, why are these news items being censored or misrepresented in Pakistani media?

Here is a plain answer. The pro-Taliban (extremist Deobandi-Wahhabi) lobby, funded and supported by Saudi Arabia (through the ISI and mullahs) is extremely influential in Pakistani media. The pro-Taliban jihadi and sectarian youth serve to act as a proxy army for the ISI’s operations in Afghanistan and Kashmir.

Hence, they would not allow an exposure of the real face of their evil ideology and its proponents to the Pakistani nation, the majority of whom follow a peaceful Barelvi, Sufi tradition of Islam. Therefore, they are misrepresenting the horrible incidents of D.I.Khan and Faisalabad as sectarian violence.

It is not sectarian violence. It is not a fight between Deobandis and Barelvis. It is a fight between extremism and multiculturalism. It is a fight between tolerance and intolerance. It is a fight between the followers of Muhammad Ali Jinnah and Mullah Omar.

It is not sectarianism. It is terrorism. The state must use its full force to protect peaceful Barelvis (and other vulnerable groups) from violence by well trained and well equipped terrorists of Taliban and Sipah-e-Sahaba.

Read more here

The Genuine Differences Among Ahl-us-Sunnah and Wahhabies / DeobandiesPaperback - 47 pages 
This brief but comprehensively covered book is a must for all households, as a safeguard for our childrens imaan. The deobandi/wahabi propaganda machine is rife amongst the youth of today. This book covers the origins and history of wahabee-ism, their beliefs, literature and leaders such as Ibn Tayymiya, and Muhammad Ibn Abd'al-Wahab and his Kitabay Tauheed.

It details the blasphemous writings of the wahabi influenced deobandi sect leaders: Ashraf Ali Thanwi, Qasim Nanotwi, Rashid Ahmad Gangohi and Khalil Ambetwi. Then their are the other wahhabi influenced sects like the Jamaat-e-Islami founded by Sayyid Abu Ala Mawdoodi, the Salafiyyah Movement, the political wahabi offshoot known as Hizb-at-Tehreer and al-Muhaajiroon. 


بسم الله الرحمن الرحيم


After praising and thanking Allâh, the Prophet (ṣallAllâh 'alayhi wa sallam) said:

"O People, lend me an attentive ear, for I know not whether after this year I shall ever be amongst you again. Therefore listen to what I am saying very carefully and take these words to those who could not be present here today.

O People, just as you regard this month, this day, this city as Sacred, so regard the life and property of every Muslim as a sacred trust. Return the goods entrusted to you to their rightful owners. Hurt no one so that no one may hurt you. Remember that you will indeed meet your Lord, and that he will indeed reckon your deeds. Allah has forbidden you to take usury (interest), therefore all interest obligations shall henceforth be waived. Your capital is yours to keep. You will neither inflict nor suffer any inequity.

Beware of Satan, for the safety of your religion. He has lost all hope of that he will be able to lead you astray in big things=(Shirk, Murder,ect... meaning>the Al-Kabair Sins, this is what the Najdee-Satanic sects don't understand), so beware of following him in small things
.

O People, it is true that you have certain rights with regard to your women but they also have rights over you. Remember that you have taken them as your wives only under Allah's trust and with His permission. If they abide by your right, then to them belongs the right to be fed and clothed in kindness. Do treat your women well and be kind to them for they are your partners and committed helpers. And it is your right that they do not make friends with anyone of whom you do not approve, as well as never to be unchaste. O People, listen to me in earnest, worship Allah, say your five daily prayers, fast during the month of Ramadhan, and give your wealth in Zakat. Perform Hajj if you can afford to.

All mankind is from Adam and Eve, an Arab has no superiority over a non-Arab nor a non-Arab has any superiority over an Arab; and a white has no superiority over a black nor a black has any superiority over a white - except by piety and good action. Learn that every Muslim is a brother to every Muslim and that the Muslims constitute one brotherhood. Nothing shall be legitimate to a Muslim which belongs to a fellow Muslim unless it was given freely and willingly. Do not therefore do injustice to yourselves. Remember one day you will meet Allah and answer your deeds. So beware: do not stray from the path of righteousness after I am gone.

O People, no prophet or apostle will come after me, and no new faith will be born. Reason well, therefore, O People, and understand my words which I convey to you. I leave behind me two things, the Qur'an and my Sunnah and if you follow these you will never go astray.

All those who listen to me shall pass on my words to others and those to others again; and may the last ones understand my words better than those who listen to me directly. Be my witness, O Allah, that I have conveyed Your message to Your people."

This sermon was delivered on the Ninth Day of Dhul-Hijjah 10 A.H. in the 'Uranah valley of Mount Arafat' in Mecca as taken from here with slight editing.]

Deobandis
 
Moderate Wahhabis or just plain Extreme ? You decide!

 

'Verily those who annoy Allah and His Messenger [salla Allahu 'alayhi wa sallam] – Allah has cursed them in this world, and in the Hereafter, and has prepared for them a humiliating torment.''        al-Qur’an  33:57


Important Distinctions : The Many Faces of Islam

Inside Wahhabi Islam
Deobandi Islam
Nature of the Problem

Deobandi Terrorism
Harkat-ul-Mujahideen
Lashkar-e-Jhanghvi
Sipah-e-Sahaba
Wahhabi and Deobandi Relationship/Ideology
Deobandi Islam :Religion of the Taliban
Wikipedia : Taliban
Taliban & British Muslims

Deobandi [Riyadh al Haq] spews hate to moderate muslims
Extremist Deobandi 'Riyadh-ul-Haq' banned from Canada
Neo Nazi support for 'Riyadh-ul-Haq'

Jihadism, Taliban & Pakistan
Was Pakistan being Talibanised?

Who are they?
''We need to form a new sect''
''Use any means or method to attract others''
''We are more Holier than thou''
Denial of the Last Prophet
Deobandi/Tablighi leader: ''I have come as a Prophet to you''
No proof of Kalima Shareef

Deoband to Bareilly : The Truth
Beliefs of the Deobandi/Tablighi Jama'at
White & Black : Facts of Deoband-ism
A Call for Justice: 'Dawaate Insaaf'
Purchase/Buy a 'Call for Justice'

Deoband Akabir Takfir 
Shaykh Nuh & Hussam al Haramayn
Radd-e-Nuh ba Fatwa Rashid-e-Gangoh

Deobandi Tricks to define Bidat

The Deoband Elders:- [under construction]
Ashrafi Ali Thanawi
Qasim Nanotwi
Khalil Ambetwi
Rashid Gangohi
Khalil Sahranpuri
Ismail Dehlawi


Ashraf Ali Thanwi acknowledges that he is a Bidati
Rashid Ahmad Gangohi is a Bidati
The Deobandi Bid'ats

Wahabi/Deobandi/Tablighi threat to moderate muslims

Shah Ismail Dehlwi : Taqwiyat al-Iman
Ideology of Intolerance

Gangohi is the 'Christ of our Time'
Fatwa of 300 Scholars [Ulema] against the Deobandi sect

Deoband 'parties'
Deoband Mawlid Controversy & Confusion
Hypocrasy in the name of Religion 
Refutation of Deoband anti-Mawlid Fatwa
Ulama of Deoband refuse to debate
Deobandis hit by Cash for Fatwas scandal

Deoband leaders detained after shooting
Deobandi Cleric held after 2 men shot
Deoband Mosque love triangle murders
More controversy surrounding Riyadh al Haq

The Imrana rape case and the Deoband edict
Deobandis in controversial Rape case fatwa

Protests against Deoband Rape case ruling

 

Wahhabism

 | Tablighi Jama'at | Qadiani | Shi'ah | Jamaat-e-Islami


Allahu la ilaha illa HuwAl-Haiyul-Qaiyume
La ta'khudhuhu sinatunow wa la naowm,
lahu ma fis-samawati wa ma fil-'ardi
Man dhal-ladhi yashfa'u 'indahu illa bi-idhnihi
Ya'lamu maa baina aidihim wa ma khalfahum,
wa la yuhituna bi shai'im-min 'ilmihee illa bima shaa'a
Wasi'a Kursiyuhus-samawati wal ard,
wa la ya'uduhu hifdhuhuma Wa Huwal 'Aliyul-Adheem


The History of Karbala

The History of Karbala    by Abu Ammar 
    [ Paperback -   pages ] 

 http://www.almuslimeen.net/books/AbuAmmar/karbala.pdf

There are several reasons for writing this booklet. My main aim is to clarify the rituals performed during the first Islamic month, Muharram. During this month the
Shi'ah (a sect) beat themselves on their chest with knives to show that they are mourning for Imam Husain May Allah be pleased with him. But the truth is that it was the shi'as of Kufa and Basra who invited Imam Husain Radi Allahu ta'ala anhu and then left him, in Karbala, to be martyred. 

--- Abu Ammar 

You can send me e-mail @ syedsaifuddinalikhan@gmail.com :

anamedinatullimwaaleaybabuha.jpg

https://www.youtube.com/watch?v=0VPZs7MWYMo

ajmerayshareefatnighttime.jpg

SULTAN-UL-HIND, KHWAJA-E-KHWAJEGAAN
HAZRAT KHWAJA MU'INUDDIN CHISTI HASAN SANJARI AJMERI
(RADI ALLAHU ANHU)

 

Sultan-ul-Hind Hazrat Khwaja Mu'inuddin Chisti Sanjari (radi Allahu anhu) popularly known as Khwaja Ghareeb Nawaaz (The Benefactor of the Poor) was the founder of the Chistiya Order of Sufis in India. He is one of the most outstanding figures in the history of Islamic Mysticism.

The Chistiya Silsila is one of the most popular and influential mystic orders in Islam. It derives its name from Chist, a village near Herat, where the real founder of the Order, Khwaja Abu Ishaq (radi Allahu anhu) of Syria, settled. Hazrat Khwaja Mu'inuddin Chisti (radi Allahu anhu) brought the Silsila to India at the close of the 11th century A.D. and established its centre in Ajmer, whence the order spread far and wide in India and became a force in the spiritual life of the Muslims.

 

Find out what happened to a prostitute when she came to the Darbar of Sulan-ul Hind Khajah Ghareebun Nawaaz , by clicking on this link below, and watch the video:!

 

http://www.youtube.com/watch?v=8yIe4tKRiOs&feature=related

Karamat - when Twaif came to darbar
to commit suicide in his holy presence.
This woman was very lucky, Don't ever try to commit suicide. Suicide is a very big SIN, the person that commits suicide shall be punished by ALLAH asavajal.  That movie star Katrina Kaif has also been there in Neqaab:
 
It's to bad Divya Bharti, and Jiah Khan wern't that fortunate.